Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	653857
Gene name	Actin related protein 3C
Gene symbol	ACTR3C
Synonyms (NCBI Gene)	ARP11
Chromosome	7
Chromosome location	7q36.1

30 Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT441271	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT441272	hsa-miR-539-3p	HITS-CLIP	24374217
MIRT441270	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT441269	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT441271	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT441272	hsa-miR-539-3p	HITS-CLIP	24374217
MIRT441270	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT441269	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT764708	hsa-miR-1251	CLIP-seq
MIRT764709	hsa-miR-190	CLIP-seq
MIRT764710	hsa-miR-190b	CLIP-seq
MIRT764711	hsa-miR-3064-3p	CLIP-seq
MIRT764712	hsa-miR-30a	CLIP-seq
MIRT764713	hsa-miR-30b	CLIP-seq
MIRT764714	hsa-miR-30c	CLIP-seq
MIRT764715	hsa-miR-30d	CLIP-seq
MIRT764716	hsa-miR-30e	CLIP-seq
MIRT764717	hsa-miR-4328	CLIP-seq
MIRT764718	hsa-miR-4495	CLIP-seq
MIRT764719	hsa-miR-4693-3p	CLIP-seq
MIRT764720	hsa-miR-4712-3p	CLIP-seq
MIRT764721	hsa-miR-4715-3p	CLIP-seq
MIRT764722	hsa-miR-4776-3p	CLIP-seq
MIRT764723	hsa-miR-518d-5p	CLIP-seq
MIRT764724	hsa-miR-519b-5p	CLIP-seq
MIRT764725	hsa-miR-519c-5p	CLIP-seq
MIRT764726	hsa-miR-520c-5p	CLIP-seq
MIRT764727	hsa-miR-526a	CLIP-seq
MIRT764728	hsa-miR-4662a-5p	CLIP-seq
MIRT764729	hsa-miR-4711-3p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9C0K3

Protein name

Actin-related protein 3C (Actin-related protein 11)

Protein function

May play a role in the suppression of metastatic potential in lung adenoma carcinoma cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00022	Actin	1 → 189	Actin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, stomach, spleen, bone marrow, uterus, testis, placenta, skeletal muscle, mammary gland, lung, fetal liver, and fetal kidney, but not detected in small intestine, brain, and thymus. Expressed in low-metastatic lung

Sequence

MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSC
IKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDP
QKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPI
DVRRPLYKMEQIPLSYPQGHGFHPLSPPFH

Sequence length

210

Interactions

View interactions

KEGG Pathway
Endocytosis
Tight junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11162478, 14651955	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14651955	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ACTR3B	[]	9	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection"]	[]
ARPC5L	[]	9	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection"]	[]
ARPC1B	[]	9	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection"]	[]
ARPC5	[]	9	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection"]	[]
ARPC4	[]	9	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection"]	[]

ACTR3C (actin related protein 3C)

Bookmark This Gene