PSMF1 (proteasome inhibitor subunit 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9491
• Gene name: Proteasome inhibitor subunit 1
• Gene symbol: PSMF1
• Synonyms (NCBI Gene): PI31
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA Show/Hide all (469)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049749	hsa-miR-92a-3p	CLASH	23622248
MIRT044684	hsa-miR-320a	CLASH	23622248
MIRT043618	hsa-miR-151a-3p	CLASH	23622248
MIRT039672	hsa-miR-615-3p	CLASH	23622248
MIRT718204	hsa-miR-451b	HITS-CLIP	19536157
MIRT718203	hsa-miR-4292	HITS-CLIP	19536157
MIRT718202	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT718201	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT718200	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT718199	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT718198	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT718197	hsa-miR-612	HITS-CLIP	19536157
MIRT718196	hsa-miR-6860	HITS-CLIP	19536157
MIRT718195	hsa-miR-1291	HITS-CLIP	19536157
MIRT718194	hsa-miR-6775-3p	HITS-CLIP	19536157
MIRT718193	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT718192	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT718191	hsa-miR-6724-5p	HITS-CLIP	19536157
MIRT718190	hsa-miR-6773-5p	HITS-CLIP	19536157
MIRT470134	hsa-miR-665	PAR-CLIP	23592263
MIRT470133	hsa-miR-9500	PAR-CLIP	23592263
MIRT470132	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT470131	hsa-miR-6736-3p	PAR-CLIP	23592263
MIRT470130	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT470129	hsa-miR-661	PAR-CLIP	23592263
MIRT470128	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT470127	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470126	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470125	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470124	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT718204	hsa-miR-451b	HITS-CLIP	19536157
MIRT718203	hsa-miR-4292	HITS-CLIP	19536157
MIRT718202	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT718201	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT718200	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT718199	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT718198	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT718197	hsa-miR-612	HITS-CLIP	19536157
MIRT718196	hsa-miR-6860	HITS-CLIP	19536157
MIRT718195	hsa-miR-1291	HITS-CLIP	19536157
MIRT718194	hsa-miR-6775-3p	HITS-CLIP	19536157
MIRT718193	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT718192	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT718191	hsa-miR-6724-5p	HITS-CLIP	19536157
MIRT718190	hsa-miR-6773-5p	HITS-CLIP	19536157
MIRT470134	hsa-miR-665	PAR-CLIP	23592263
MIRT470133	hsa-miR-9500	PAR-CLIP	23592263
MIRT470132	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT470131	hsa-miR-6736-3p	PAR-CLIP	23592263
MIRT470130	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT470129	hsa-miR-661	PAR-CLIP	23592263
MIRT470128	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT470127	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470126	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470125	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470124	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT1270958	hsa-miR-2277-3p	CLIP-seq
MIRT1270959	hsa-miR-3144-5p	CLIP-seq
MIRT1270960	hsa-miR-3191	CLIP-seq
MIRT1270961	hsa-miR-4652-5p	CLIP-seq
MIRT1270962	hsa-miR-628-5p	CLIP-seq
MIRT1270963	hsa-miR-1185	CLIP-seq
MIRT1270964	hsa-miR-1283	CLIP-seq
MIRT1270965	hsa-miR-151-5p	CLIP-seq
MIRT1270966	hsa-miR-151b	CLIP-seq
MIRT1270967	hsa-miR-185	CLIP-seq
MIRT1270968	hsa-miR-1912	CLIP-seq
MIRT1270969	hsa-miR-1915	CLIP-seq
MIRT1270970	hsa-miR-200b	CLIP-seq
MIRT1270971	hsa-miR-200c	CLIP-seq
MIRT1270972	hsa-miR-203	CLIP-seq
MIRT1270973	hsa-miR-2053	CLIP-seq
MIRT1270974	hsa-miR-3130-5p	CLIP-seq
MIRT1270975	hsa-miR-3131	CLIP-seq
MIRT1270976	hsa-miR-3146	CLIP-seq
MIRT1270977	hsa-miR-3189-3p	CLIP-seq
MIRT1270978	hsa-miR-320b	CLIP-seq
MIRT1270979	hsa-miR-320c	CLIP-seq
MIRT1270980	hsa-miR-320d	CLIP-seq
MIRT1270981	hsa-miR-3591-3p	CLIP-seq
MIRT1270982	hsa-miR-3646	CLIP-seq
MIRT1270983	hsa-miR-3663-5p	CLIP-seq
MIRT1270984	hsa-miR-3679-5p	CLIP-seq
MIRT1270985	hsa-miR-369-3p	CLIP-seq
MIRT1270986	hsa-miR-3907	CLIP-seq
MIRT1270987	hsa-miR-421	CLIP-seq
MIRT1270988	hsa-miR-4257	CLIP-seq
MIRT1270989	hsa-miR-4270	CLIP-seq
MIRT1270990	hsa-miR-4287	CLIP-seq
MIRT1270991	hsa-miR-429	CLIP-seq
MIRT1270992	hsa-miR-4293	CLIP-seq
MIRT1270993	hsa-miR-4294	CLIP-seq
MIRT1270994	hsa-miR-4306	CLIP-seq
MIRT1270995	hsa-miR-4429	CLIP-seq
MIRT1270996	hsa-miR-4436b-5p	CLIP-seq
MIRT1270997	hsa-miR-4441	CLIP-seq
MIRT1270998	hsa-miR-4469	CLIP-seq
MIRT1270999	hsa-miR-4482	CLIP-seq
MIRT1271000	hsa-miR-4484	CLIP-seq
MIRT1271001	hsa-miR-4509	CLIP-seq
MIRT1271002	hsa-miR-4535	CLIP-seq
MIRT1271003	hsa-miR-4641	CLIP-seq
MIRT1271004	hsa-miR-4644	CLIP-seq
MIRT1271005	hsa-miR-4685-3p	CLIP-seq
MIRT1271006	hsa-miR-4691-5p	CLIP-seq
MIRT1271007	hsa-miR-4695-3p	CLIP-seq
MIRT1271008	hsa-miR-4717-3p	CLIP-seq
MIRT1271009	hsa-miR-4747-5p	CLIP-seq
MIRT1271010	hsa-miR-4753-5p	CLIP-seq
MIRT1271011	hsa-miR-4765	CLIP-seq
MIRT1271012	hsa-miR-4780	CLIP-seq
MIRT1271013	hsa-miR-4781-3p	CLIP-seq
MIRT1271014	hsa-miR-4786-3p	CLIP-seq
MIRT1271015	hsa-miR-4795-5p	CLIP-seq
MIRT1271016	hsa-miR-490-5p	CLIP-seq
MIRT1271017	hsa-miR-492	CLIP-seq
MIRT1271018	hsa-miR-493	CLIP-seq
MIRT1271019	hsa-miR-499-3p	CLIP-seq
MIRT1271020	hsa-miR-499a-3p	CLIP-seq
MIRT1271021	hsa-miR-548an	CLIP-seq
MIRT1271022	hsa-miR-548q	CLIP-seq
MIRT1271023	hsa-miR-596	CLIP-seq
MIRT1271024	hsa-miR-611	CLIP-seq
MIRT1271025	hsa-miR-623	CLIP-seq
MIRT1270962	hsa-miR-628-5p	CLIP-seq
MIRT1270978	hsa-miR-320b	CLIP-seq
MIRT1270979	hsa-miR-320c	CLIP-seq
MIRT1270980	hsa-miR-320d	CLIP-seq
MIRT1270995	hsa-miR-4429	CLIP-seq
MIRT2079722	hsa-miR-1184	CLIP-seq
MIRT2079723	hsa-miR-28-5p	CLIP-seq
MIRT2079724	hsa-miR-3139	CLIP-seq
MIRT2079725	hsa-miR-3614-3p	CLIP-seq
MIRT2079726	hsa-miR-4660	CLIP-seq
MIRT2079727	hsa-miR-4698	CLIP-seq
MIRT2079728	hsa-miR-659	CLIP-seq
MIRT2079729	hsa-miR-708	CLIP-seq
MIRT2079730	hsa-miR-1273g	CLIP-seq
MIRT1270986	hsa-miR-3907	CLIP-seq
MIRT1270992	hsa-miR-4293	CLIP-seq
MIRT1271007	hsa-miR-4695-3p	CLIP-seq
MIRT1271022	hsa-miR-548q	CLIP-seq
MIRT1271023	hsa-miR-596	CLIP-seq
MIRT2079722	hsa-miR-1184	CLIP-seq
MIRT2305998	hsa-miR-1245	CLIP-seq
MIRT2305999	hsa-miR-188-5p	CLIP-seq
MIRT2306000	hsa-miR-191	CLIP-seq
MIRT1270970	hsa-miR-200b	CLIP-seq
MIRT1270971	hsa-miR-200c	CLIP-seq
MIRT2306001	hsa-miR-217	CLIP-seq
MIRT2306002	hsa-miR-221	CLIP-seq
MIRT2306003	hsa-miR-222	CLIP-seq
MIRT2306004	hsa-miR-2276	CLIP-seq
MIRT2079723	hsa-miR-28-5p	CLIP-seq
MIRT2306005	hsa-miR-2964a-5p	CLIP-seq
MIRT2306006	hsa-miR-3120-3p	CLIP-seq
MIRT2306007	hsa-miR-3124-3p	CLIP-seq
MIRT2079724	hsa-miR-3139	CLIP-seq
MIRT1270959	hsa-miR-3144-5p	CLIP-seq
MIRT2306008	hsa-miR-3154	CLIP-seq
MIRT2306009	hsa-miR-3160-3p	CLIP-seq
MIRT2306010	hsa-miR-3179	CLIP-seq
MIRT1270978	hsa-miR-320b	CLIP-seq
MIRT1270979	hsa-miR-320c	CLIP-seq
MIRT1270980	hsa-miR-320d	CLIP-seq
MIRT2306011	hsa-miR-3606	CLIP-seq
MIRT2306012	hsa-miR-361-3p	CLIP-seq
MIRT2306013	hsa-miR-3677-5p	CLIP-seq
MIRT2306014	hsa-miR-3692	CLIP-seq
MIRT1270985	hsa-miR-369-3p	CLIP-seq
MIRT2306015	hsa-miR-3908	CLIP-seq
MIRT2306016	hsa-miR-3934	CLIP-seq
MIRT2306017	hsa-miR-3975	CLIP-seq
MIRT1270991	hsa-miR-429	CLIP-seq
MIRT2306018	hsa-miR-4300	CLIP-seq
MIRT2306019	hsa-miR-4313	CLIP-seq
MIRT1270995	hsa-miR-4429	CLIP-seq
MIRT2306020	hsa-miR-4433	CLIP-seq
MIRT1270996	hsa-miR-4436b-5p	CLIP-seq
MIRT2306021	hsa-miR-4437	CLIP-seq
MIRT2306022	hsa-miR-4459	CLIP-seq
MIRT2306023	hsa-miR-4460	CLIP-seq
MIRT1271001	hsa-miR-4509	CLIP-seq
MIRT2306024	hsa-miR-4527	CLIP-seq
MIRT2306025	hsa-miR-4635	CLIP-seq
MIRT2079726	hsa-miR-4660	CLIP-seq
MIRT2306026	hsa-miR-4686	CLIP-seq
MIRT2306027	hsa-miR-4694-3p	CLIP-seq
MIRT2306028	hsa-miR-4696	CLIP-seq
MIRT2306029	hsa-miR-4727-3p	CLIP-seq
MIRT2306030	hsa-miR-4744	CLIP-seq
MIRT1271010	hsa-miR-4753-5p	CLIP-seq
MIRT1271011	hsa-miR-4765	CLIP-seq
MIRT2306031	hsa-miR-4773	CLIP-seq
MIRT1271012	hsa-miR-4780	CLIP-seq
MIRT1271014	hsa-miR-4786-3p	CLIP-seq
MIRT2306032	hsa-miR-508-5p	CLIP-seq
MIRT2306033	hsa-miR-522	CLIP-seq
MIRT2306034	hsa-miR-548v	CLIP-seq
MIRT2306035	hsa-miR-553	CLIP-seq
MIRT2306036	hsa-miR-570	CLIP-seq
MIRT2306037	hsa-miR-586	CLIP-seq
MIRT1271023	hsa-miR-596	CLIP-seq
MIRT2306038	hsa-miR-603	CLIP-seq
MIRT2306039	hsa-miR-618	CLIP-seq
MIRT1271025	hsa-miR-623	CLIP-seq
MIRT2306040	hsa-miR-646	CLIP-seq
MIRT2079729	hsa-miR-708	CLIP-seq
MIRT2306041	hsa-miR-711	CLIP-seq
MIRT2306042	hsa-miR-765	CLIP-seq
MIRT2306043	hsa-miR-920	CLIP-seq
MIRT2306044	hsa-miR-921	CLIP-seq
MIRT2306002	hsa-miR-221	CLIP-seq
MIRT2306003	hsa-miR-222	CLIP-seq
MIRT2306006	hsa-miR-3120-3p	CLIP-seq
MIRT2306034	hsa-miR-548v	CLIP-seq
MIRT2603225	hsa-miR-101	CLIP-seq
MIRT1270963	hsa-miR-1185	CLIP-seq
MIRT2603226	hsa-miR-1203	CLIP-seq
MIRT2603227	hsa-miR-1252	CLIP-seq
MIRT2603228	hsa-miR-125a-5p	CLIP-seq
MIRT2603229	hsa-miR-125b	CLIP-seq
MIRT2603230	hsa-miR-1266	CLIP-seq
MIRT2603231	hsa-miR-1271	CLIP-seq
MIRT2603232	hsa-miR-1303	CLIP-seq
MIRT2603233	hsa-miR-138	CLIP-seq
MIRT2603234	hsa-miR-139-5p	CLIP-seq
MIRT2603235	hsa-miR-141	CLIP-seq
MIRT2603236	hsa-miR-144	CLIP-seq
MIRT2603237	hsa-miR-1471	CLIP-seq
MIRT1270965	hsa-miR-151-5p	CLIP-seq
MIRT1270966	hsa-miR-151b	CLIP-seq
MIRT2603238	hsa-miR-154	CLIP-seq
MIRT1270967	hsa-miR-185	CLIP-seq
MIRT1270968	hsa-miR-1912	CLIP-seq
MIRT1270969	hsa-miR-1915	CLIP-seq
MIRT2603239	hsa-miR-193a-5p	CLIP-seq
MIRT2603240	hsa-miR-1972	CLIP-seq
MIRT2603241	hsa-miR-200a	CLIP-seq
MIRT2603242	hsa-miR-2115	CLIP-seq
MIRT2603243	hsa-miR-2116	CLIP-seq
MIRT2603244	hsa-miR-2117	CLIP-seq
MIRT2306001	hsa-miR-217	CLIP-seq
MIRT2603245	hsa-miR-2278	CLIP-seq
MIRT2603246	hsa-miR-2467-5p	CLIP-seq
MIRT2079723	hsa-miR-28-5p	CLIP-seq
MIRT2603247	hsa-miR-2861	CLIP-seq
MIRT2306007	hsa-miR-3124-3p	CLIP-seq
MIRT2603248	hsa-miR-3130-3p	CLIP-seq
MIRT1270974	hsa-miR-3130-5p	CLIP-seq
MIRT1270975	hsa-miR-3131	CLIP-seq
MIRT2603249	hsa-miR-3135	CLIP-seq
MIRT2079724	hsa-miR-3139	CLIP-seq
MIRT1270976	hsa-miR-3146	CLIP-seq
MIRT2603250	hsa-miR-3150b-3p	CLIP-seq
MIRT2603251	hsa-miR-3155	CLIP-seq
MIRT2603252	hsa-miR-3155b	CLIP-seq
MIRT2603253	hsa-miR-3188	CLIP-seq
MIRT1270977	hsa-miR-3189-3p	CLIP-seq
MIRT2603254	hsa-miR-3200-5p	CLIP-seq
MIRT2603255	hsa-miR-323-5p	CLIP-seq
MIRT2603256	hsa-miR-326	CLIP-seq
MIRT2603257	hsa-miR-330-3p	CLIP-seq
MIRT2603258	hsa-miR-330-5p	CLIP-seq
MIRT2603259	hsa-miR-342-5p	CLIP-seq
MIRT2603260	hsa-miR-345	CLIP-seq
MIRT1270981	hsa-miR-3591-3p	CLIP-seq
MIRT1270983	hsa-miR-3663-5p	CLIP-seq
MIRT2603261	hsa-miR-3664-3p	CLIP-seq
MIRT1270984	hsa-miR-3679-5p	CLIP-seq
MIRT2306014	hsa-miR-3692	CLIP-seq
MIRT2603262	hsa-miR-371-5p	CLIP-seq
MIRT2603263	hsa-miR-371b-5p	CLIP-seq
MIRT2603264	hsa-miR-376a	CLIP-seq
MIRT2603265	hsa-miR-376b	CLIP-seq
MIRT1270986	hsa-miR-3907	CLIP-seq
MIRT2603266	hsa-miR-3913-3p	CLIP-seq
MIRT2603267	hsa-miR-3922-5p	CLIP-seq
MIRT2603268	hsa-miR-3944-3p	CLIP-seq
MIRT2306017	hsa-miR-3975	CLIP-seq
MIRT1270989	hsa-miR-4270	CLIP-seq
MIRT2603269	hsa-miR-4273	CLIP-seq
MIRT2603270	hsa-miR-4286	CLIP-seq
MIRT1270990	hsa-miR-4287	CLIP-seq
MIRT1270992	hsa-miR-4293	CLIP-seq
MIRT1270993	hsa-miR-4294	CLIP-seq
MIRT1270994	hsa-miR-4306	CLIP-seq
MIRT2603271	hsa-miR-4319	CLIP-seq
MIRT2603272	hsa-miR-4328	CLIP-seq
MIRT2603273	hsa-miR-4434	CLIP-seq
MIRT1270996	hsa-miR-4436b-5p	CLIP-seq
MIRT2306021	hsa-miR-4437	CLIP-seq
MIRT1270997	hsa-miR-4441	CLIP-seq
MIRT2603274	hsa-miR-4456	CLIP-seq
MIRT2603275	hsa-miR-4457	CLIP-seq
MIRT1270998	hsa-miR-4469	CLIP-seq
MIRT1270999	hsa-miR-4482	CLIP-seq
MIRT2603276	hsa-miR-4487	CLIP-seq
MIRT1271001	hsa-miR-4509	CLIP-seq
MIRT2603277	hsa-miR-4516	CLIP-seq
MIRT2603278	hsa-miR-4518	CLIP-seq
MIRT2603279	hsa-miR-4522	CLIP-seq
MIRT1271004	hsa-miR-4644	CLIP-seq
MIRT2603280	hsa-miR-4649-3p	CLIP-seq
MIRT2603281	hsa-miR-4650-5p	CLIP-seq
MIRT2603282	hsa-miR-4651	CLIP-seq
MIRT2603283	hsa-miR-4652-3p	CLIP-seq
MIRT2603284	hsa-miR-4656	CLIP-seq
MIRT2603285	hsa-miR-4659a-5p	CLIP-seq
MIRT2603286	hsa-miR-4659b-5p	CLIP-seq
MIRT2603287	hsa-miR-4661-3p	CLIP-seq
MIRT2603288	hsa-miR-4664-5p	CLIP-seq
MIRT2603289	hsa-miR-4667-5p	CLIP-seq
MIRT2603290	hsa-miR-4677-5p	CLIP-seq
MIRT1271005	hsa-miR-4685-3p	CLIP-seq
MIRT1271007	hsa-miR-4695-3p	CLIP-seq
MIRT2079727	hsa-miR-4698	CLIP-seq
MIRT2603291	hsa-miR-4700-5p	CLIP-seq
MIRT2603292	hsa-miR-4707-3p	CLIP-seq
MIRT2603293	hsa-miR-4711-5p	CLIP-seq
MIRT2603294	hsa-miR-4725-5p	CLIP-seq
MIRT2603295	hsa-miR-4732-3p	CLIP-seq
MIRT2306030	hsa-miR-4744	CLIP-seq
MIRT1271009	hsa-miR-4747-5p	CLIP-seq
MIRT2603296	hsa-miR-4756-3p	CLIP-seq
MIRT2306031	hsa-miR-4773	CLIP-seq
MIRT2603297	hsa-miR-4776-3p	CLIP-seq
MIRT2603298	hsa-miR-4777-3p	CLIP-seq
MIRT1271012	hsa-miR-4780	CLIP-seq
MIRT1271013	hsa-miR-4781-3p	CLIP-seq
MIRT2603299	hsa-miR-4784	CLIP-seq
MIRT2603300	hsa-miR-4793-3p	CLIP-seq
MIRT1271015	hsa-miR-4795-5p	CLIP-seq
MIRT2603301	hsa-miR-4799-5p	CLIP-seq
MIRT2603302	hsa-miR-483-3p	CLIP-seq
MIRT2603303	hsa-miR-484	CLIP-seq
MIRT2603304	hsa-miR-485-5p	CLIP-seq
MIRT1271018	hsa-miR-493	CLIP-seq
MIRT2603305	hsa-miR-498	CLIP-seq
MIRT2603306	hsa-miR-504	CLIP-seq
MIRT2306032	hsa-miR-508-5p	CLIP-seq
MIRT2603307	hsa-miR-515-5p	CLIP-seq
MIRT2603308	hsa-miR-548m	CLIP-seq
MIRT1271022	hsa-miR-548q	CLIP-seq
MIRT2306034	hsa-miR-548v	CLIP-seq
MIRT2306036	hsa-miR-570	CLIP-seq
MIRT1271023	hsa-miR-596	CLIP-seq
MIRT2603309	hsa-miR-608	CLIP-seq
MIRT1271024	hsa-miR-611	CLIP-seq
MIRT2603310	hsa-miR-621	CLIP-seq
MIRT1271025	hsa-miR-623	CLIP-seq
MIRT1270962	hsa-miR-628-5p	CLIP-seq
MIRT2603311	hsa-miR-637	CLIP-seq
MIRT2079728	hsa-miR-659	CLIP-seq
MIRT2603312	hsa-miR-670	CLIP-seq
MIRT2079729	hsa-miR-708	CLIP-seq
MIRT2603313	hsa-miR-875-5p	CLIP-seq
MIRT2603314	hsa-miR-876-3p	CLIP-seq
MIRT2603315	hsa-miR-96	CLIP-seq
MIRT2603225	hsa-miR-101	CLIP-seq
MIRT1270963	hsa-miR-1185	CLIP-seq
MIRT2603230	hsa-miR-1266	CLIP-seq
MIRT2603232	hsa-miR-1303	CLIP-seq
MIRT2603233	hsa-miR-138	CLIP-seq
MIRT2603234	hsa-miR-139-5p	CLIP-seq
MIRT2603235	hsa-miR-141	CLIP-seq
MIRT2603236	hsa-miR-144	CLIP-seq
MIRT2603237	hsa-miR-1471	CLIP-seq
MIRT1270965	hsa-miR-151-5p	CLIP-seq
MIRT1270966	hsa-miR-151b	CLIP-seq
MIRT2603238	hsa-miR-154	CLIP-seq
MIRT1270967	hsa-miR-185	CLIP-seq
MIRT1270968	hsa-miR-1912	CLIP-seq
MIRT1270969	hsa-miR-1915	CLIP-seq
MIRT2603239	hsa-miR-193a-5p	CLIP-seq
MIRT2603240	hsa-miR-1972	CLIP-seq
MIRT2603241	hsa-miR-200a	CLIP-seq
MIRT2603243	hsa-miR-2116	CLIP-seq
MIRT2603244	hsa-miR-2117	CLIP-seq
MIRT2306001	hsa-miR-217	CLIP-seq
MIRT2603245	hsa-miR-2278	CLIP-seq
MIRT2603246	hsa-miR-2467-5p	CLIP-seq
MIRT2079723	hsa-miR-28-5p	CLIP-seq
MIRT2603247	hsa-miR-2861	CLIP-seq
MIRT2306007	hsa-miR-3124-3p	CLIP-seq
MIRT2603248	hsa-miR-3130-3p	CLIP-seq
MIRT1270974	hsa-miR-3130-5p	CLIP-seq
MIRT1270975	hsa-miR-3131	CLIP-seq
MIRT2603249	hsa-miR-3135	CLIP-seq
MIRT2079724	hsa-miR-3139	CLIP-seq
MIRT1270976	hsa-miR-3146	CLIP-seq
MIRT2603251	hsa-miR-3155	CLIP-seq
MIRT2603252	hsa-miR-3155b	CLIP-seq
MIRT2603253	hsa-miR-3188	CLIP-seq
MIRT1270977	hsa-miR-3189-3p	CLIP-seq
MIRT2603254	hsa-miR-3200-5p	CLIP-seq
MIRT2603255	hsa-miR-323-5p	CLIP-seq
MIRT2603256	hsa-miR-326	CLIP-seq
MIRT2603257	hsa-miR-330-3p	CLIP-seq
MIRT2603258	hsa-miR-330-5p	CLIP-seq
MIRT1270983	hsa-miR-3663-5p	CLIP-seq
MIRT2603261	hsa-miR-3664-3p	CLIP-seq
MIRT1270984	hsa-miR-3679-5p	CLIP-seq
MIRT2306014	hsa-miR-3692	CLIP-seq
MIRT2603262	hsa-miR-371-5p	CLIP-seq
MIRT2603263	hsa-miR-371b-5p	CLIP-seq
MIRT1270986	hsa-miR-3907	CLIP-seq
MIRT2603266	hsa-miR-3913-3p	CLIP-seq
MIRT2603268	hsa-miR-3944-3p	CLIP-seq
MIRT2306017	hsa-miR-3975	CLIP-seq
MIRT1270989	hsa-miR-4270	CLIP-seq
MIRT2603269	hsa-miR-4273	CLIP-seq
MIRT2603270	hsa-miR-4286	CLIP-seq
MIRT1270990	hsa-miR-4287	CLIP-seq
MIRT1270992	hsa-miR-4293	CLIP-seq
MIRT1270993	hsa-miR-4294	CLIP-seq
MIRT1270994	hsa-miR-4306	CLIP-seq
MIRT2603272	hsa-miR-4328	CLIP-seq
MIRT1270996	hsa-miR-4436b-5p	CLIP-seq
MIRT2306021	hsa-miR-4437	CLIP-seq
MIRT1270997	hsa-miR-4441	CLIP-seq
MIRT2688864	hsa-miR-4453	CLIP-seq
MIRT2603274	hsa-miR-4456	CLIP-seq
MIRT1270998	hsa-miR-4469	CLIP-seq
MIRT1270999	hsa-miR-4482	CLIP-seq
MIRT2603276	hsa-miR-4487	CLIP-seq
MIRT2603278	hsa-miR-4518	CLIP-seq
MIRT2688865	hsa-miR-4538	CLIP-seq
MIRT1271004	hsa-miR-4644	CLIP-seq
MIRT2603280	hsa-miR-4649-3p	CLIP-seq
MIRT2603281	hsa-miR-4650-5p	CLIP-seq
MIRT2603283	hsa-miR-4652-3p	CLIP-seq
MIRT2603285	hsa-miR-4659a-5p	CLIP-seq
MIRT2603286	hsa-miR-4659b-5p	CLIP-seq
MIRT2603290	hsa-miR-4677-5p	CLIP-seq
MIRT1271005	hsa-miR-4685-3p	CLIP-seq
MIRT1271007	hsa-miR-4695-3p	CLIP-seq
MIRT2079727	hsa-miR-4698	CLIP-seq
MIRT2603292	hsa-miR-4707-3p	CLIP-seq
MIRT2603293	hsa-miR-4711-5p	CLIP-seq
MIRT2603294	hsa-miR-4725-5p	CLIP-seq
MIRT1271009	hsa-miR-4747-5p	CLIP-seq
MIRT2603296	hsa-miR-4756-3p	CLIP-seq
MIRT2306031	hsa-miR-4773	CLIP-seq
MIRT2603297	hsa-miR-4776-3p	CLIP-seq
MIRT2603298	hsa-miR-4777-3p	CLIP-seq
MIRT1271012	hsa-miR-4780	CLIP-seq
MIRT1271013	hsa-miR-4781-3p	CLIP-seq
MIRT2603300	hsa-miR-4793-3p	CLIP-seq
MIRT1271015	hsa-miR-4795-5p	CLIP-seq
MIRT2603302	hsa-miR-483-3p	CLIP-seq
MIRT2603303	hsa-miR-484	CLIP-seq
MIRT2603304	hsa-miR-485-5p	CLIP-seq
MIRT1271018	hsa-miR-493	CLIP-seq
MIRT2603306	hsa-miR-504	CLIP-seq
MIRT2306032	hsa-miR-508-5p	CLIP-seq
MIRT2603307	hsa-miR-515-5p	CLIP-seq
MIRT1271022	hsa-miR-548q	CLIP-seq
MIRT2306034	hsa-miR-548v	CLIP-seq
MIRT2306036	hsa-miR-570	CLIP-seq
MIRT1271023	hsa-miR-596	CLIP-seq
MIRT1271024	hsa-miR-611	CLIP-seq
MIRT2603310	hsa-miR-621	CLIP-seq
MIRT1271025	hsa-miR-623	CLIP-seq
MIRT1270962	hsa-miR-628-5p	CLIP-seq
MIRT2079728	hsa-miR-659	CLIP-seq
MIRT2079729	hsa-miR-708	CLIP-seq
MIRT2603313	hsa-miR-875-5p	CLIP-seq
MIRT2603314	hsa-miR-876-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	NAS	10764772
GO:0005515	Function	Protein binding	IPI	16000308, 16713569, 19060904, 21988832, 25416956, 25910212, 26496610, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	18495667
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	18495667
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	NAS	10764772
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	10764772
GO:0016020	Component	Membrane	HDA	19946888
GO:0042803	Function	Protein homodimerization activity	IPI	18495667
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	18495667
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18495667
GO:0070628	Function	Proteasome binding	IDA	10764772
GO:0070628	Function	Proteasome binding	IEA
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	IDA	10764772

Other IDs

• MIM: 617858
• HGNC: 9571
• e!Ensembl: ENSG00000125818

Protein

• UniProt ID: Q92530
• Protein name: Proteasome inhibitor PI31 subunit (hPI31)
• Protein function: Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28. {ECO
• PDB: 2VT8 , 4OUH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08577	PI31_Prot_C	153 → 248	PI31 proteasome regulator	Family
  PF11566	PI31_Prot_N	11 → 149	PI31 proteasome regulator N-terminal	Family

• Sequence:

  MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNN
  NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDF
  HRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR
  QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPG
  ARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

• Sequence length: 271

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
	Cross-presentation of soluble exogenous antigens (endosomes)
	Autodegradation of Cdh1 by Cdh1:APC/C
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (10)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	31585107	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31585107		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36295489	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34867951	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMB9 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMB10 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMB8 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSME1 51 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +39 more Related via 51 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMD5 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMB9	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMB10	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMB8	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSME1	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMD5	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]

Diseases Linked via Similar Genes

Proteasome associated autoinflammatory syndrome Linked via 3 of 5 related genesPSMB9, PSMB10, PSMB8 Autoimmune disease Linked via 2 of 5 related genesPSMB9, PSMD5 Hypothyroidism Linked via 2 of 5 related genesPSMB9, PSMB8 Rheumatoid arthritis Linked via 2 of 5 related genesPSMB9, PSMB8 Systemic lupus erythematosus Linked via 2 of 5 related genesPSMB9, PSMB8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Proteasome associated autoinflammatory syndrome	3	["PSMB9","PSMB10","PSMB8"]
Autoimmune disease	2	["PSMB9","PSMD5"]
Hypothyroidism	2	["PSMB9","PSMB8"]
Rheumatoid arthritis	2	["PSMB9","PSMB8"]
Systemic lupus erythematosus	2	["PSMB9","PSMB8"]