Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5698
Gene name	Proteasome 20S subunit beta 9
Gene symbol	PSMB9
Synonyms (NCBI Gene)	LMP2PRAAS3PRAAS6PSMB6iRING12beta1i
Chromosome	6
Chromosome location	6p21.32
Summary	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

SNP ID	Visualize variation	Clinical significance	Consequence
rs369359789	G>A	Pathogenic	Missense variant, coding sequence variant

101 Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT683914	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT683913	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT683912	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT683911	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT683910	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT683909	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT683908	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT683907	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT683906	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT683905	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT683904	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683903	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT683902	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT683901	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT683900	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT683899	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT683898	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT683897	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT683896	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT683895	hsa-miR-498	HITS-CLIP	23313552
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508790	hsa-miR-29b-2-5p	PAR-CLIP	23446348
MIRT508788	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT508787	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT683914	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT683913	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT683912	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT683911	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT683910	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT683909	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT683908	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT683907	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT683906	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT683905	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT683904	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683903	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT683902	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT683901	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT683900	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT683899	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT683898	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT683897	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT683896	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT683895	hsa-miR-498	HITS-CLIP	23313552
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508790	hsa-miR-29b-2-5p	PAR-CLIP	23446348
MIRT508788	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT508787	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT2602938	hsa-miR-1224-3p	CLIP-seq
MIRT2602939	hsa-miR-125a-5p	CLIP-seq
MIRT2602940	hsa-miR-125b	CLIP-seq
MIRT2602941	hsa-miR-1291	CLIP-seq
MIRT2602942	hsa-miR-328	CLIP-seq
MIRT2602943	hsa-miR-3663-3p	CLIP-seq
MIRT2602944	hsa-miR-3913-3p	CLIP-seq
MIRT2602945	hsa-miR-4266	CLIP-seq
MIRT2602946	hsa-miR-4287	CLIP-seq
MIRT2602947	hsa-miR-4319	CLIP-seq
MIRT2602948	hsa-miR-4469	CLIP-seq
MIRT2602949	hsa-miR-4685-3p	CLIP-seq
MIRT2602950	hsa-miR-4695-5p	CLIP-seq
MIRT2602951	hsa-miR-4732-3p	CLIP-seq
MIRT2602952	hsa-miR-4779	CLIP-seq
MIRT2602953	hsa-miR-489	CLIP-seq
MIRT2602954	hsa-miR-591	CLIP-seq
MIRT2602955	hsa-miR-670	CLIP-seq
MIRT2602938	hsa-miR-1224-3p	CLIP-seq
MIRT2602939	hsa-miR-125a-5p	CLIP-seq
MIRT2602940	hsa-miR-125b	CLIP-seq
MIRT2602941	hsa-miR-1291	CLIP-seq
MIRT2602942	hsa-miR-328	CLIP-seq
MIRT2602943	hsa-miR-3663-3p	CLIP-seq
MIRT2602944	hsa-miR-3913-3p	CLIP-seq
MIRT2602945	hsa-miR-4266	CLIP-seq
MIRT2602946	hsa-miR-4287	CLIP-seq
MIRT2602947	hsa-miR-4319	CLIP-seq
MIRT2602948	hsa-miR-4469	CLIP-seq
MIRT2602949	hsa-miR-4685-3p	CLIP-seq
MIRT2602950	hsa-miR-4695-5p	CLIP-seq
MIRT2602951	hsa-miR-4732-3p	CLIP-seq
MIRT2602952	hsa-miR-4779	CLIP-seq
MIRT2602953	hsa-miR-489	CLIP-seq
MIRT2688856	hsa-miR-520d-5p	CLIP-seq
MIRT2688857	hsa-miR-524-5p	CLIP-seq
MIRT2688858	hsa-miR-556-3p	CLIP-seq
MIRT2602954	hsa-miR-591	CLIP-seq
MIRT2602955	hsa-miR-670	CLIP-seq

6 Show/Hide all (6)

Transcription factor	Regulation	Reference
IRF1	Activation	18694960
IRF1	Unknown	10764778;10921891;16703666;9632673
NFKB1	Unknown	18694960
RELA	Unknown	18694960
SEC14L2	Unknown	7699330
STAT1	Unknown	10764778;10921891;16703666;9632673

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	TAS	8666937
GO:0002376	Process	Immune system process	IEA
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 16957778, 18985028, 20723761, 28514442, 30833792, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	IBA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	26524591
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1990111	Component	Spermatoproteasome complex	ISS

MIM	HGNC	e!Ensembl
177045	9546	ENSG00000240065

P28065

Protein name

Proteasome subunit beta type-9 (EC 3.4.25.1) (Low molecular mass protein 2) (Macropain chain 7) (Multicatalytic endopeptidase complex chain 7) (Proteasome chain 7) (Proteasome subunit beta-1i) (Really interesting new gene 12 protein)

Protein function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (PubMed:33727065, PubMed:34819510). The

PDB

6AVO , 6E5B , 7AWE , 7B12 , 9FST

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	17 → 198	Proteasome subunit	Domain

Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Sequence length

219

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
	Cross-presentation of soluble exogenous antigens (endosomes)
	Autodegradation of Cdh1 by Cdh1:APC/C
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Proteasome-associated autoinflammatory syndrome 6	Pathogenic	rs2127399518	RCV004556086	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
proteasome-associated autoinflammatory syndrome with immunodeficiency (PRAAS-ID)	Pathogenic	rs2127399518	RCV001732235	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (33)
Acute myeloid leukemia	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	32534018	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROIDITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	39620209	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	38368726	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteasome-associated autoinflammatory syndrome 3	Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet, GenCC Disgenet, GenCC	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PSMB9-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	39885523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	36762574, 37377963, 38368726, 39620209	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	32771030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	37377963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (166)
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acrodermatitis	Dermatitis	CTD_human_DG	27258892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24377540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23628820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29315015, 30396848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	20153157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10648037, 22034108, 31702633, 7763114, 8311558, 9306872, 9348140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	Pubtator	7763114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMB4	1	["Proteasome associated autoinflammatory syndrome"]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	4	["ClinVar (Proteasome associated autoinflammatory syndrome)","HPO (Proteasome associated autoinflammatory syndrome)","Disgenet (Proteasome associated autoinflammatory syndrome)","GenCC (Proteasome associated autoinflammatory syndrome)"]
PSMB10	1	["Proteasome associated autoinflammatory syndrome"]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	3	["ClinVar (Proteasome associated autoinflammatory syndrome)","HPO (Proteasome associated autoinflammatory syndrome)","Disgenet (Proteasome associated autoinflammatory syndrome)"]
PSMB8	1	["Proteasome associated autoinflammatory syndrome"]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	3	["ClinVar (Proteasome associated autoinflammatory syndrome)","HPO (Proteasome associated autoinflammatory syndrome)","Disgenet (Proteasome associated autoinflammatory syndrome)"]
RAB5C	3	["Autoimmune disease","Autoimmune thyroid disease","Vitiligo"]	0	[]	1	["GWAS catalog (Autoimmune disease)"]
PSMF1	0	[]	51	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]

PSMB9 (proteasome 20S subunit beta 9)

Bookmark This Gene