PSMD10 (proteasome 26S subunit, non-ATPase 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5716
• Gene name: Proteasome 26S subunit, non-ATPase 10
• Gene symbol: PSMD10
• Synonyms (NCBI Gene): dJ889N15.2, p28, p28(GANK)
• Chromosome: X
• Chromosome location: Xq22.3
• Summary: This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in

miRNA Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023306	hsa-miR-122-5p	Proteomics	21750653
MIRT035545	hsa-miR-214-3p	Luciferase reporter assay	23100276
MIRT044545	hsa-miR-320a	CLASH	23622248
MIRT036871	hsa-miR-877-3p	CLASH	23622248
MIRT438269	hsa-miR-605-5p	Luciferase reporter assay, Western blot	25131931
MIRT438269	hsa-miR-605-5p	Luciferase reporter assay, Western blot	25131931
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270397	hsa-miR-1470	CLIP-seq
MIRT1270398	hsa-miR-188-5p	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT1270401	hsa-miR-2964a-5p	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT1270407	hsa-miR-3662	CLIP-seq
MIRT1270408	hsa-miR-376a	CLIP-seq
MIRT1270409	hsa-miR-376b	CLIP-seq
MIRT1270410	hsa-miR-380	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270412	hsa-miR-425	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT1270414	hsa-miR-431	CLIP-seq
MIRT1270415	hsa-miR-4432	CLIP-seq
MIRT1270416	hsa-miR-4495	CLIP-seq
MIRT1270417	hsa-miR-4667-3p	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT1270420	hsa-miR-4719	CLIP-seq
MIRT1270421	hsa-miR-493	CLIP-seq
MIRT1270422	hsa-miR-499-5p	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT1270426	hsa-miR-539	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270428	hsa-miR-581	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2305760	hsa-miR-1197	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT2305761	hsa-miR-3144-5p	CLIP-seq
MIRT2305762	hsa-miR-3191	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2305763	hsa-miR-3674	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2305765	hsa-miR-4652-5p	CLIP-seq
MIRT2305766	hsa-miR-4667-5p	CLIP-seq
MIRT2305767	hsa-miR-4700-5p	CLIP-seq
MIRT1270420	hsa-miR-4719	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2602996	hsa-miR-1245b-5p	CLIP-seq
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT2602997	hsa-miR-1258	CLIP-seq
MIRT2602998	hsa-miR-1265	CLIP-seq
MIRT2602999	hsa-miR-1273d	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT2603000	hsa-miR-2278	CLIP-seq
MIRT2603001	hsa-miR-2392	CLIP-seq
MIRT2603002	hsa-miR-30a	CLIP-seq
MIRT2603003	hsa-miR-30b	CLIP-seq
MIRT2603004	hsa-miR-30c	CLIP-seq
MIRT2603005	hsa-miR-30d	CLIP-seq
MIRT2603006	hsa-miR-30e	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT2603007	hsa-miR-3126-3p	CLIP-seq
MIRT2603008	hsa-miR-3128	CLIP-seq
MIRT2603009	hsa-miR-3142	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT2603010	hsa-miR-331-5p	CLIP-seq
MIRT2603011	hsa-miR-3613-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2603012	hsa-miR-3653	CLIP-seq
MIRT2603013	hsa-miR-3658	CLIP-seq
MIRT2603014	hsa-miR-376c	CLIP-seq
MIRT2603015	hsa-miR-3919	CLIP-seq
MIRT2603016	hsa-miR-3928	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2603017	hsa-miR-4307	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2603018	hsa-miR-4652-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2603019	hsa-miR-4678	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT2603020	hsa-miR-4720-5p	CLIP-seq
MIRT2603021	hsa-miR-4756-3p	CLIP-seq
MIRT2603022	hsa-miR-4765	CLIP-seq
MIRT2603023	hsa-miR-4773	CLIP-seq
MIRT2603024	hsa-miR-4799-3p	CLIP-seq
MIRT2603025	hsa-miR-4802-5p	CLIP-seq
MIRT2603026	hsa-miR-494	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT2603027	hsa-miR-548a-3p	CLIP-seq
MIRT2603028	hsa-miR-548aa	CLIP-seq
MIRT2603029	hsa-miR-548e	CLIP-seq
MIRT2603030	hsa-miR-548f	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT2603031	hsa-miR-651	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT2603032	hsa-miR-759	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT2603033	hsa-miR-765	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2603034	hsa-miR-936	CLIP-seq
MIRT2602996	hsa-miR-1245b-5p	CLIP-seq
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT2602997	hsa-miR-1258	CLIP-seq
MIRT2602998	hsa-miR-1265	CLIP-seq
MIRT2602999	hsa-miR-1273d	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT2603000	hsa-miR-2278	CLIP-seq
MIRT2603001	hsa-miR-2392	CLIP-seq
MIRT2603002	hsa-miR-30a	CLIP-seq
MIRT2603003	hsa-miR-30b	CLIP-seq
MIRT2603004	hsa-miR-30c	CLIP-seq
MIRT2603005	hsa-miR-30d	CLIP-seq
MIRT2603006	hsa-miR-30e	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT2603007	hsa-miR-3126-3p	CLIP-seq
MIRT2603008	hsa-miR-3128	CLIP-seq
MIRT2603009	hsa-miR-3142	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT2603010	hsa-miR-331-5p	CLIP-seq
MIRT2603011	hsa-miR-3613-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2603012	hsa-miR-3653	CLIP-seq
MIRT2603013	hsa-miR-3658	CLIP-seq
MIRT1270407	hsa-miR-3662	CLIP-seq
MIRT2603014	hsa-miR-376c	CLIP-seq
MIRT2603016	hsa-miR-3928	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2603017	hsa-miR-4307	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2603018	hsa-miR-4652-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2603019	hsa-miR-4678	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT2603020	hsa-miR-4720-5p	CLIP-seq
MIRT2603022	hsa-miR-4765	CLIP-seq
MIRT2603023	hsa-miR-4773	CLIP-seq
MIRT2603024	hsa-miR-4799-3p	CLIP-seq
MIRT2603025	hsa-miR-4802-5p	CLIP-seq
MIRT2603026	hsa-miR-494	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT2603027	hsa-miR-548a-3p	CLIP-seq
MIRT2603028	hsa-miR-548aa	CLIP-seq
MIRT2603029	hsa-miR-548e	CLIP-seq
MIRT2603030	hsa-miR-548f	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT2603031	hsa-miR-651	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT2603032	hsa-miR-759	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT2603033	hsa-miR-765	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2603034	hsa-miR-936	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16023600
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	10613832, 11900540, 12525503, 16023600, 16189514, 17003112, 18040287, 19490896, 21988832, 24338975, 25416956, 26972000, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18040287
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	18040287
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005929	Component	Cilium	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IDA	19490896
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0030307	Process	Positive regulation of cell growth	IDA	10613832
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	16023600
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	16023600
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	10613832
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16023600
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19729910
GO:0043409	Process	Negative regulation of MAPK cascade	IMP	19729910
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	16023600
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	11900540
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IBA
GO:0070682	Process	Proteasome regulatory particle assembly	IMP	19490896
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IMP	19729910

Other IDs

• MIM: 300880
• HGNC: 9555
• e!Ensembl: ENSG00000101843

Protein

• UniProt ID: O75832
• Protein name: 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))
• Protein function: Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably a
• PDB: 1QYM , 1TR4 , 1UOH , 4NIK , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 7VO6 , 7VXV , 7VXW , 7VY4 , 7VY7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	8 → 103	Ankyrin repeats (3 copies)	Repeat
  PF13637	Ank_4	40 → 93		Repeat
  PF13637	Ank_4	73 → 126		Repeat
  PF13637	Ank_4	139 → 184		Repeat

• Tissue specificity: TISSUE SPECIFICITY: Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level). {ECO:0000269|PubMed:10613832, ECO:0000269|PubMed:20628200}.
• Sequence:

  MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
  QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
  IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
  DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG

• Sequence length: 226

Pathways

Reactome Pathway

Activation of NF-kappaB in B cells

Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha

Cross-presentation of soluble exogenous antigens (endosomes)

Autodegradation of Cdh1 by Cdh1:APC/C

SCF-beta-TrCP mediated degradation of Emi1

APC/C:Cdc20 mediated degradation of Securin

APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1

Cdc20:Phospho-APC/C mediated degradation of Cyclin A

Vpu mediated degradation of CD4

Vif-mediated degradation of APOBEC3G

SCF(Skp2)-mediated degradation of p27/p21

Degradation of beta-catenin by the destruction complex

Downstream TCR signaling

Separation of Sister Chromatids

FCERI mediated NF-kB activation

Autodegradation of the E3 ubiquitin ligase COP1

Regulation of ornithine decarboxylase (ODC)

ABC-family proteins mediated transport

AUF1 (hnRNP D0) binds and destabilizes mRNA

Asymmetric localization of PCP proteins

Degradation of AXIN

Degradation of DVL

Hedgehog ligand biogenesis

Hh mutants that don't undergo autocatalytic processing are degraded by ERAD

Dectin-1 mediated noncanonical NF-kB signaling

CLEC7A (Dectin-1) signaling

Degradation of GLI1 by the proteasome

GLI3 is processed to GLI3R by the proteasome

Hedgehog 'on' state

Regulation of RAS by GAPs

TNFR2 non-canonical NF-kB pathway

NIK-->noncanonical NF-kB signaling

Defective CFTR causes cystic fibrosis

MAPK6/MAPK4 signaling

UCH proteinases

Ub-specific processing proteases

CDT1 association with the CDC6:ORC:origin complex

Orc1 removal from chromatin

CDK-mediated phosphorylation and removal of Cdc6

G2/M Checkpoints

Ubiquitin Mediated Degradation of Phosphorylated Cdc25A

Ubiquitin-dependent degradation of Cyclin D

The role of GTSE1 in G2/M progression after G2 checkpoint

FBXL7 down-regulates AURKA during mitotic entry and in early mitosis

RUNX1 regulates transcription of genes involved in differentiation of HSCs

Regulation of RUNX2 expression and activity

Regulation of RUNX3 expression and activity

Regulation of PTEN stability and activity

Neddylation

Interleukin-1 signaling

Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMD5 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases. PSMB9 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases. PSMB10 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases. PSMF1 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases. PSMB8 50 shared pathwaysRegulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +38 more Related via 50 shared pathways including Regulation of PTEN stability and activity, Ub-specific processing proteases.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMD5	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMB9	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMB10	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMF1	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMB8	0	[]	50	["Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]

Diseases Linked via Similar Genes

Proteasome associated autoinflammatory syndrome Linked via 3 of 5 related genesPSMB9, PSMB10, PSMB8 Autoimmune disease Linked via 2 of 5 related genesPSMD5, PSMB9 Hypothyroidism Linked via 2 of 5 related genesPSMB9, PSMB8 Rheumatoid arthritis Linked via 2 of 5 related genesPSMB9, PSMB8 Systemic lupus erythematosus Linked via 2 of 5 related genesPSMB9, PSMB8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Proteasome associated autoinflammatory syndrome	3	["PSMB9","PSMB10","PSMB8"]
Autoimmune disease	2	["PSMD5","PSMB9"]
Hypothyroidism	2	["PSMB9","PSMB8"]
Rheumatoid arthritis	2	["PSMB9","PSMB8"]
Systemic lupus erythematosus	2	["PSMB9","PSMB8"]