Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5714
Gene name	Proteasome 26S subunit, non-ATPase 8
Gene symbol	PSMD8
Synonyms (NCBI Gene)	HEL-S-91nHIP6HYPFNin1pRpn12S14p31
Chromosome	19
Chromosome location	19q13.2
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

106 Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048193	hsa-miR-196a-5p	CLASH	23622248
MIRT045550	hsa-miR-149-5p	CLASH	23622248
MIRT045234	hsa-miR-186-5p	CLASH	23622248
MIRT042550	hsa-miR-423-3p	CLASH	23622248
MIRT041805	hsa-miR-484	CLASH	23622248
MIRT040097	hsa-miR-615-3p	CLASH	23622248
MIRT039343	hsa-miR-425-5p	CLASH	23622248
MIRT1270688	hsa-miR-10a	CLIP-seq
MIRT1270689	hsa-miR-10b	CLIP-seq
MIRT1270690	hsa-miR-1263	CLIP-seq
MIRT1270691	hsa-miR-4490	CLIP-seq
MIRT1270692	hsa-miR-4774-5p	CLIP-seq
MIRT1270693	hsa-miR-548c-3p	CLIP-seq
MIRT1270694	hsa-miR-653	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079563	hsa-miR-1197	CLIP-seq
MIRT2079564	hsa-miR-1205	CLIP-seq
MIRT2079565	hsa-miR-128	CLIP-seq
MIRT2079566	hsa-miR-1972	CLIP-seq
MIRT2079567	hsa-miR-1976	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079572	hsa-miR-4420	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2079574	hsa-miR-4717-5p	CLIP-seq
MIRT2079575	hsa-miR-4729	CLIP-seq
MIRT2079576	hsa-miR-4731-5p	CLIP-seq
MIRT2079577	hsa-miR-4760-3p	CLIP-seq
MIRT2079578	hsa-miR-512-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603137	hsa-miR-1	CLIP-seq
MIRT2603138	hsa-miR-1254	CLIP-seq
MIRT2603139	hsa-miR-1910	CLIP-seq
MIRT2603140	hsa-miR-206	CLIP-seq
MIRT2603141	hsa-miR-223	CLIP-seq
MIRT2603142	hsa-miR-2861	CLIP-seq
MIRT2603143	hsa-miR-3116	CLIP-seq
MIRT2603144	hsa-miR-3130-5p	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2603145	hsa-miR-3150a-3p	CLIP-seq
MIRT2603146	hsa-miR-3175	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT2603147	hsa-miR-3942-3p	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2603148	hsa-miR-4482	CLIP-seq
MIRT2603149	hsa-miR-4511	CLIP-seq
MIRT2603150	hsa-miR-4512	CLIP-seq
MIRT2603151	hsa-miR-455-3p	CLIP-seq
MIRT2603152	hsa-miR-4649-5p	CLIP-seq
MIRT2603153	hsa-miR-4667-5p	CLIP-seq
MIRT2603154	hsa-miR-4697-3p	CLIP-seq
MIRT2603155	hsa-miR-4700-5p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603156	hsa-miR-548b-3p	CLIP-seq
MIRT2603157	hsa-miR-593	CLIP-seq
MIRT2603158	hsa-miR-613	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2603159	hsa-miR-7	CLIP-seq
MIRT2603160	hsa-miR-939	CLIP-seq
MIRT2603137	hsa-miR-1	CLIP-seq
MIRT2603138	hsa-miR-1254	CLIP-seq
MIRT2603139	hsa-miR-1910	CLIP-seq
MIRT2603140	hsa-miR-206	CLIP-seq
MIRT2603141	hsa-miR-223	CLIP-seq
MIRT2603142	hsa-miR-2861	CLIP-seq
MIRT2603143	hsa-miR-3116	CLIP-seq
MIRT2603144	hsa-miR-3130-5p	CLIP-seq
MIRT2079568	hsa-miR-3140-5p	CLIP-seq
MIRT2603145	hsa-miR-3150a-3p	CLIP-seq
MIRT2603146	hsa-miR-3175	CLIP-seq
MIRT2305905	hsa-miR-3189-5p	CLIP-seq
MIRT2079569	hsa-miR-3612	CLIP-seq
MIRT2079570	hsa-miR-365	CLIP-seq
MIRT2305906	hsa-miR-3691-3p	CLIP-seq
MIRT2603147	hsa-miR-3942-3p	CLIP-seq
MIRT2079571	hsa-miR-3975	CLIP-seq
MIRT2079573	hsa-miR-4443	CLIP-seq
MIRT2603148	hsa-miR-4482	CLIP-seq
MIRT2603149	hsa-miR-4511	CLIP-seq
MIRT2603150	hsa-miR-4512	CLIP-seq
MIRT2603151	hsa-miR-455-3p	CLIP-seq
MIRT2603153	hsa-miR-4667-5p	CLIP-seq
MIRT2603154	hsa-miR-4697-3p	CLIP-seq
MIRT2603155	hsa-miR-4700-5p	CLIP-seq
MIRT1552661	hsa-miR-4758-3p	CLIP-seq
MIRT2079579	hsa-miR-515-5p	CLIP-seq
MIRT2603156	hsa-miR-548b-3p	CLIP-seq
MIRT2603157	hsa-miR-593	CLIP-seq
MIRT2603158	hsa-miR-613	CLIP-seq
MIRT2079580	hsa-miR-650	CLIP-seq
MIRT2603159	hsa-miR-7	CLIP-seq
MIRT2603160	hsa-miR-939	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	16990800, 29290612, 32296183, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0005838	Component	Proteasome regulatory particle	TAS	7621825
GO:0006508	Process	Proteolysis	IEA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	ISS
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727

MIM	HGNC	e!Ensembl
617844	9566	ENSG00000099341

P48556

Protein name

26S proteasome non-ATPase regulatory subunit 8 (26S proteasome regulatory subunit RPN12) (26S proteasome regulatory subunit S14) (p31)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M , 8CVT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10075	CSN8_PSD8_EIF3K	186 → 327	CSN8/PSMD8/EIF3K family	Family

Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAA
SRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLK
LVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKE
QLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGS
YNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMT
DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Sequence length

350

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSMC2	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC3	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC4	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC5	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC6	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]

PSMD8 (proteasome 26S subunit, non-ATPase 8)

Bookmark This Gene