PSMD7 (proteasome 26S subunit, non-ATPase 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5713
• Gene name: Proteasome 26S subunit, non-ATPase 7
• Gene symbol: PSMD7
• Synonyms (NCBI Gene): MOV34, P40, Rpn8, S12
• Chromosome: 16
• Chromosome location: 16q23.1
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA Show/Hide all (433)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029210	hsa-miR-26b-5p	Microarray	19088304
MIRT046509	hsa-miR-15b-5p	CLASH	23622248
MIRT043500	hsa-miR-331-3p	CLASH	23622248
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT075447	hsa-miR-548ag	PAR-CLIP	20371350
MIRT075449	hsa-miR-548ai	PAR-CLIP	20371350
MIRT075454	hsa-miR-548ba	PAR-CLIP	20371350
MIRT075444	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT075443	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT075455	hsa-miR-8076	PAR-CLIP	20371350
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	20371350
MIRT501483	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT075450	hsa-miR-4487	PAR-CLIP	20371350
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT075451	hsa-miR-6126	PAR-CLIP	20371350
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT075447	hsa-miR-548ag	PAR-CLIP	20371350
MIRT075449	hsa-miR-548ai	PAR-CLIP	20371350
MIRT075454	hsa-miR-548ba	PAR-CLIP	20371350
MIRT075444	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT075443	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT075455	hsa-miR-8076	PAR-CLIP	20371350
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	20371350
MIRT501483	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT075450	hsa-miR-4487	PAR-CLIP	20371350
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT075451	hsa-miR-6126	PAR-CLIP	20371350
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT075447	hsa-miR-548ag	PAR-CLIP	21572407
MIRT075449	hsa-miR-548ai	PAR-CLIP	21572407
MIRT075454	hsa-miR-548ba	PAR-CLIP	21572407
MIRT075444	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT075443	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT075455	hsa-miR-8076	PAR-CLIP	21572407
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT555178	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT501483	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT075450	hsa-miR-4487	PAR-CLIP	21572407
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT075451	hsa-miR-6126	PAR-CLIP	21572407
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	21572407
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT075447	hsa-miR-548ag	PAR-CLIP	21572407
MIRT075449	hsa-miR-548ai	PAR-CLIP	21572407
MIRT075454	hsa-miR-548ba	PAR-CLIP	21572407
MIRT075444	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT075443	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT075455	hsa-miR-8076	PAR-CLIP	21572407
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT501483	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT075450	hsa-miR-4487	PAR-CLIP	21572407
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT075451	hsa-miR-6126	PAR-CLIP	21572407
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	21572407
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	24398324
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	24398324
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	24398324
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	24398324
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	24398324
MIRT075447	hsa-miR-548ag	PAR-CLIP	24398324
MIRT075449	hsa-miR-548ai	PAR-CLIP	24398324
MIRT075454	hsa-miR-548ba	PAR-CLIP	24398324
MIRT075444	hsa-miR-570-5p	PAR-CLIP	24398324
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	24398324
MIRT075443	hsa-miR-338-5p	PAR-CLIP	24398324
MIRT075455	hsa-miR-8076	PAR-CLIP	24398324
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	24398324
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	24398324
MIRT501483	hsa-miR-493-3p	PAR-CLIP	24398324
MIRT075450	hsa-miR-4487	PAR-CLIP	24398324
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	24398324
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT075451	hsa-miR-6126	PAR-CLIP	24398324
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	24398324
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT075447	hsa-miR-548ag	PAR-CLIP	20371350
MIRT075449	hsa-miR-548ai	PAR-CLIP	20371350
MIRT075454	hsa-miR-548ba	PAR-CLIP	20371350
MIRT075444	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT075443	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT075455	hsa-miR-8076	PAR-CLIP	20371350
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	20371350
MIRT501483	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT075450	hsa-miR-4487	PAR-CLIP	20371350
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT075451	hsa-miR-6126	PAR-CLIP	20371350
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT075447	hsa-miR-548ag	PAR-CLIP	20371350
MIRT075449	hsa-miR-548ai	PAR-CLIP	20371350
MIRT075454	hsa-miR-548ba	PAR-CLIP	20371350
MIRT075444	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT075443	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT075455	hsa-miR-8076	PAR-CLIP	20371350
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	20371350
MIRT501483	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT075450	hsa-miR-4487	PAR-CLIP	20371350
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT075451	hsa-miR-6126	PAR-CLIP	20371350
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT075447	hsa-miR-548ag	PAR-CLIP	21572407
MIRT075449	hsa-miR-548ai	PAR-CLIP	21572407
MIRT075454	hsa-miR-548ba	PAR-CLIP	21572407
MIRT075444	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT075443	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT075455	hsa-miR-8076	PAR-CLIP	21572407
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT555178	hsa-miR-5003-5p	PAR-CLIP	21572407
MIRT501483	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT075450	hsa-miR-4487	PAR-CLIP	21572407
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT075451	hsa-miR-6126	PAR-CLIP	21572407
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	21572407
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT075447	hsa-miR-548ag	PAR-CLIP	21572407
MIRT075449	hsa-miR-548ai	PAR-CLIP	21572407
MIRT075454	hsa-miR-548ba	PAR-CLIP	21572407
MIRT075444	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT075443	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT075455	hsa-miR-8076	PAR-CLIP	21572407
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT501483	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT075450	hsa-miR-4487	PAR-CLIP	21572407
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT075451	hsa-miR-6126	PAR-CLIP	21572407
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	21572407
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	24398324
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	24398324
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	24398324
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	24398324
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	24398324
MIRT075447	hsa-miR-548ag	PAR-CLIP	24398324
MIRT075449	hsa-miR-548ai	PAR-CLIP	24398324
MIRT075454	hsa-miR-548ba	PAR-CLIP	24398324
MIRT075444	hsa-miR-570-5p	PAR-CLIP	24398324
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	24398324
MIRT075443	hsa-miR-338-5p	PAR-CLIP	24398324
MIRT075455	hsa-miR-8076	PAR-CLIP	24398324
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	24398324
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	24398324
MIRT501483	hsa-miR-493-3p	PAR-CLIP	24398324
MIRT075450	hsa-miR-4487	PAR-CLIP	24398324
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	24398324
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT075451	hsa-miR-6126	PAR-CLIP	24398324
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	24398324
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT1270636	hsa-miR-1185	CLIP-seq
MIRT1270637	hsa-miR-1251	CLIP-seq
MIRT1270638	hsa-miR-125a-5p	CLIP-seq
MIRT1270639	hsa-miR-125b	CLIP-seq
MIRT1270640	hsa-miR-1287	CLIP-seq
MIRT1270641	hsa-miR-140-3p	CLIP-seq
MIRT1270642	hsa-miR-15a	CLIP-seq
MIRT1270643	hsa-miR-15b	CLIP-seq
MIRT1270644	hsa-miR-16	CLIP-seq
MIRT1270645	hsa-miR-195	CLIP-seq
MIRT1270646	hsa-miR-198	CLIP-seq
MIRT1270647	hsa-miR-29a	CLIP-seq
MIRT1270648	hsa-miR-29b	CLIP-seq
MIRT1270649	hsa-miR-29c	CLIP-seq
MIRT1270650	hsa-miR-30a	CLIP-seq
MIRT1270651	hsa-miR-30b	CLIP-seq
MIRT1270652	hsa-miR-30c	CLIP-seq
MIRT1270653	hsa-miR-30d	CLIP-seq
MIRT1270654	hsa-miR-30e	CLIP-seq
MIRT1270655	hsa-miR-3115	CLIP-seq
MIRT1270656	hsa-miR-3120-3p	CLIP-seq
MIRT1270657	hsa-miR-3133	CLIP-seq
MIRT1270658	hsa-miR-3160-5p	CLIP-seq
MIRT1270659	hsa-miR-3605-5p	CLIP-seq
MIRT1270660	hsa-miR-3650	CLIP-seq
MIRT1270661	hsa-miR-3679-5p	CLIP-seq
MIRT1270662	hsa-miR-3908	CLIP-seq
MIRT1270663	hsa-miR-3919	CLIP-seq
MIRT1270664	hsa-miR-3925-5p	CLIP-seq
MIRT1270665	hsa-miR-3942-5p	CLIP-seq
MIRT1270666	hsa-miR-424	CLIP-seq
MIRT1270667	hsa-miR-4263	CLIP-seq
MIRT1270668	hsa-miR-4319	CLIP-seq
MIRT1270669	hsa-miR-4436b-5p	CLIP-seq
MIRT1270670	hsa-miR-451b	CLIP-seq
MIRT1270671	hsa-miR-4524	CLIP-seq
MIRT1270672	hsa-miR-4536	CLIP-seq
MIRT1270673	hsa-miR-4539	CLIP-seq
MIRT1270674	hsa-miR-4680-5p	CLIP-seq
MIRT1270675	hsa-miR-4703-5p	CLIP-seq
MIRT1270676	hsa-miR-4760-3p	CLIP-seq
MIRT1270677	hsa-miR-4766-3p	CLIP-seq
MIRT1270678	hsa-miR-4803	CLIP-seq
MIRT1270679	hsa-miR-493	CLIP-seq
MIRT1270680	hsa-miR-497	CLIP-seq
MIRT1270681	hsa-miR-503	CLIP-seq
MIRT1270682	hsa-miR-544b	CLIP-seq
MIRT1270683	hsa-miR-548b-3p	CLIP-seq
MIRT1270684	hsa-miR-576-5p	CLIP-seq
MIRT1270685	hsa-miR-586	CLIP-seq
MIRT1270686	hsa-miR-618	CLIP-seq
MIRT1270687	hsa-miR-646	CLIP-seq
MIRT1270636	hsa-miR-1185	CLIP-seq
MIRT1270638	hsa-miR-125a-5p	CLIP-seq
MIRT1270639	hsa-miR-125b	CLIP-seq
MIRT1270640	hsa-miR-1287	CLIP-seq
MIRT2079554	hsa-miR-1303	CLIP-seq
MIRT1270641	hsa-miR-140-3p	CLIP-seq
MIRT2079555	hsa-miR-1911	CLIP-seq
MIRT1270646	hsa-miR-198	CLIP-seq
MIRT1270647	hsa-miR-29a	CLIP-seq
MIRT1270648	hsa-miR-29b	CLIP-seq
MIRT1270649	hsa-miR-29c	CLIP-seq
MIRT1270655	hsa-miR-3115	CLIP-seq
MIRT1270656	hsa-miR-3120-3p	CLIP-seq
MIRT1270659	hsa-miR-3605-5p	CLIP-seq
MIRT2079556	hsa-miR-3646	CLIP-seq
MIRT2079557	hsa-miR-3647-3p	CLIP-seq
MIRT1270661	hsa-miR-3679-5p	CLIP-seq
MIRT2079558	hsa-miR-3915	CLIP-seq
MIRT2079559	hsa-miR-3928	CLIP-seq
MIRT2079560	hsa-miR-4272	CLIP-seq
MIRT1270668	hsa-miR-4319	CLIP-seq
MIRT1270670	hsa-miR-451b	CLIP-seq
MIRT2079561	hsa-miR-4709-3p	CLIP-seq
MIRT1270682	hsa-miR-544b	CLIP-seq
MIRT2079562	hsa-miR-577	CLIP-seq
MIRT1270636	hsa-miR-1185	CLIP-seq
MIRT1270638	hsa-miR-125a-5p	CLIP-seq
MIRT1270639	hsa-miR-125b	CLIP-seq
MIRT1270640	hsa-miR-1287	CLIP-seq
MIRT2305890	hsa-miR-136	CLIP-seq
MIRT1270641	hsa-miR-140-3p	CLIP-seq
MIRT2305891	hsa-miR-1827	CLIP-seq
MIRT1270647	hsa-miR-29a	CLIP-seq
MIRT1270648	hsa-miR-29b	CLIP-seq
MIRT1270649	hsa-miR-29c	CLIP-seq
MIRT1270650	hsa-miR-30a	CLIP-seq
MIRT1270651	hsa-miR-30b	CLIP-seq
MIRT1270652	hsa-miR-30c	CLIP-seq
MIRT1270653	hsa-miR-30d	CLIP-seq
MIRT1270654	hsa-miR-30e	CLIP-seq
MIRT1270655	hsa-miR-3115	CLIP-seq
MIRT1270656	hsa-miR-3120-3p	CLIP-seq
MIRT2305892	hsa-miR-3147	CLIP-seq
MIRT2305893	hsa-miR-3160-3p	CLIP-seq
MIRT1270658	hsa-miR-3160-5p	CLIP-seq
MIRT1270659	hsa-miR-3605-5p	CLIP-seq
MIRT2305894	hsa-miR-3612	CLIP-seq
MIRT1270661	hsa-miR-3679-5p	CLIP-seq
MIRT1270662	hsa-miR-3908	CLIP-seq
MIRT1270663	hsa-miR-3919	CLIP-seq
MIRT1270664	hsa-miR-3925-5p	CLIP-seq
MIRT2305895	hsa-miR-3942-3p	CLIP-seq
MIRT1270665	hsa-miR-3942-5p	CLIP-seq
MIRT2305896	hsa-miR-421	CLIP-seq
MIRT1270667	hsa-miR-4263	CLIP-seq
MIRT2305897	hsa-miR-4293	CLIP-seq
MIRT1270668	hsa-miR-4319	CLIP-seq
MIRT2305898	hsa-miR-4425	CLIP-seq
MIRT1270669	hsa-miR-4436b-5p	CLIP-seq
MIRT1270670	hsa-miR-451b	CLIP-seq
MIRT2305899	hsa-miR-4666-3p	CLIP-seq
MIRT1270675	hsa-miR-4703-5p	CLIP-seq
MIRT2305900	hsa-miR-4709-5p	CLIP-seq
MIRT1270677	hsa-miR-4766-3p	CLIP-seq
MIRT2305901	hsa-miR-4786-3p	CLIP-seq
MIRT1270678	hsa-miR-4803	CLIP-seq
MIRT1270679	hsa-miR-493	CLIP-seq
MIRT1270682	hsa-miR-544b	CLIP-seq
MIRT2305902	hsa-miR-558	CLIP-seq
MIRT1270684	hsa-miR-576-5p	CLIP-seq
MIRT1270685	hsa-miR-586	CLIP-seq
MIRT2305903	hsa-miR-622	CLIP-seq
MIRT2305904	hsa-miR-650	CLIP-seq
MIRT2603123	hsa-miR-1236	CLIP-seq
MIRT2079554	hsa-miR-1303	CLIP-seq
MIRT2305890	hsa-miR-136	CLIP-seq
MIRT1270641	hsa-miR-140-3p	CLIP-seq
MIRT2305891	hsa-miR-1827	CLIP-seq
MIRT2079555	hsa-miR-1911	CLIP-seq
MIRT1270647	hsa-miR-29a	CLIP-seq
MIRT1270648	hsa-miR-29b	CLIP-seq
MIRT1270649	hsa-miR-29c	CLIP-seq
MIRT1270656	hsa-miR-3120-3p	CLIP-seq
MIRT2305892	hsa-miR-3147	CLIP-seq
MIRT1270658	hsa-miR-3160-5p	CLIP-seq
MIRT2603124	hsa-miR-320a	CLIP-seq
MIRT2603125	hsa-miR-320b	CLIP-seq
MIRT2603126	hsa-miR-320c	CLIP-seq
MIRT2603127	hsa-miR-320d	CLIP-seq
MIRT2305894	hsa-miR-3612	CLIP-seq
MIRT2079556	hsa-miR-3646	CLIP-seq
MIRT2079557	hsa-miR-3647-3p	CLIP-seq
MIRT2079558	hsa-miR-3915	CLIP-seq
MIRT2079559	hsa-miR-3928	CLIP-seq
MIRT2305895	hsa-miR-3942-3p	CLIP-seq
MIRT1270667	hsa-miR-4263	CLIP-seq
MIRT2079560	hsa-miR-4272	CLIP-seq
MIRT2305897	hsa-miR-4293	CLIP-seq
MIRT2305898	hsa-miR-4425	CLIP-seq
MIRT2603128	hsa-miR-4429	CLIP-seq
MIRT1270670	hsa-miR-451b	CLIP-seq
MIRT2305899	hsa-miR-4666-3p	CLIP-seq
MIRT2079561	hsa-miR-4709-3p	CLIP-seq
MIRT2603129	hsa-miR-4753-3p	CLIP-seq
MIRT2305901	hsa-miR-4786-3p	CLIP-seq
MIRT2603130	hsa-miR-485-3p	CLIP-seq
MIRT2603131	hsa-miR-498	CLIP-seq
MIRT1270681	hsa-miR-503	CLIP-seq
MIRT1270684	hsa-miR-576-5p	CLIP-seq
MIRT2079562	hsa-miR-577	CLIP-seq
MIRT2603132	hsa-miR-579	CLIP-seq
MIRT2603133	hsa-miR-617	CLIP-seq
MIRT2305903	hsa-miR-622	CLIP-seq
MIRT2305904	hsa-miR-650	CLIP-seq
MIRT2603134	hsa-miR-653	CLIP-seq
MIRT2603135	hsa-miR-924	CLIP-seq
MIRT2603136	hsa-miR-942	CLIP-seq
MIRT2603123	hsa-miR-1236	CLIP-seq
MIRT2079554	hsa-miR-1303	CLIP-seq
MIRT2305890	hsa-miR-136	CLIP-seq
MIRT1270641	hsa-miR-140-3p	CLIP-seq
MIRT2305891	hsa-miR-1827	CLIP-seq
MIRT2079555	hsa-miR-1911	CLIP-seq
MIRT1270647	hsa-miR-29a	CLIP-seq
MIRT1270648	hsa-miR-29b	CLIP-seq
MIRT1270649	hsa-miR-29c	CLIP-seq
MIRT1270656	hsa-miR-3120-3p	CLIP-seq
MIRT2305892	hsa-miR-3147	CLIP-seq
MIRT2603124	hsa-miR-320a	CLIP-seq
MIRT2603125	hsa-miR-320b	CLIP-seq
MIRT2603126	hsa-miR-320c	CLIP-seq
MIRT2603127	hsa-miR-320d	CLIP-seq
MIRT2305894	hsa-miR-3612	CLIP-seq
MIRT2079556	hsa-miR-3646	CLIP-seq
MIRT2079557	hsa-miR-3647-3p	CLIP-seq
MIRT2079558	hsa-miR-3915	CLIP-seq
MIRT2079559	hsa-miR-3928	CLIP-seq
MIRT2305895	hsa-miR-3942-3p	CLIP-seq
MIRT2079560	hsa-miR-4272	CLIP-seq
MIRT2305898	hsa-miR-4425	CLIP-seq
MIRT2603128	hsa-miR-4429	CLIP-seq
MIRT1270670	hsa-miR-451b	CLIP-seq
MIRT2305899	hsa-miR-4666-3p	CLIP-seq
MIRT2079561	hsa-miR-4709-3p	CLIP-seq
MIRT2603129	hsa-miR-4753-3p	CLIP-seq
MIRT2603130	hsa-miR-485-3p	CLIP-seq
MIRT2603131	hsa-miR-498	CLIP-seq
MIRT1270681	hsa-miR-503	CLIP-seq
MIRT2079562	hsa-miR-577	CLIP-seq
MIRT2603132	hsa-miR-579	CLIP-seq
MIRT2603133	hsa-miR-617	CLIP-seq
MIRT2305903	hsa-miR-622	CLIP-seq
MIRT2305904	hsa-miR-650	CLIP-seq
MIRT2603134	hsa-miR-653	CLIP-seq
MIRT2603135	hsa-miR-924	CLIP-seq
MIRT2603136	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IBA
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0005515	Function	Protein binding	IPI	19615732, 22078707, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0005838	Component	Proteasome regulatory particle	TAS	7755639
GO:0008233	Function	Peptidase activity	IKR	17559875
GO:0016020	Component	Membrane	HDA	19946888
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042803	Function	Protein homodimerization activity	IDA	17559875
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0140492	Function	Metal-dependent deubiquitinase activity	IKR	17559875
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 157970
• HGNC: 9565
• e!Ensembl: ENSG00000103035

Protein

• UniProt ID: P51665
• Protein name: 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 2O95 , 2O96 , 5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01398	JAB	4 → 118	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
  PF13012	MitMem_reg	166 → 277	Maintenance of mitochondrial structure and function	Family

• Sequence:

  MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
  DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
  LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
  DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
  SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
  KEDKEKDKDKEKSDVKKEEKKEKK

• Sequence length: 324

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	Neutrophil degranulation
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMC2 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC3 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC4 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC5 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC6 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMC2	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC3	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC4	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC5	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC6	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesPSMC3, PSMC6 Neurodevelopmental disorder Linked via 2 of 5 related genesPSMC3, PSMC5 Hearing loss Linked via 1 of 5 related genesPSMC2 Diabetes mellitus type 2 Linked via 1 of 5 related genesPSMC2 Anomalous pulmonary venous Linked via 1 of 5 related genesPSMC3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["PSMC3","PSMC6"]
Neurodevelopmental disorder	2	["PSMC3","PSMC5"]
Hearing loss	1	["PSMC2"]
Diabetes mellitus type 2	1	["PSMC2"]
Anomalous pulmonary venous	1	["PSMC3"]