Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	221914
Gene name	Glypican 2
Gene symbol	GPC2
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q22.1

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT1028565	hsa-miR-1207-3p	CLIP-seq
MIRT1028566	hsa-miR-146b-3p	CLIP-seq
MIRT1028567	hsa-miR-205	CLIP-seq
MIRT1028568	hsa-miR-2355-5p	CLIP-seq
MIRT1028569	hsa-miR-3127-3p	CLIP-seq
MIRT1028570	hsa-miR-3144-3p	CLIP-seq
MIRT1028571	hsa-miR-3146	CLIP-seq
MIRT1028572	hsa-miR-3173-5p	CLIP-seq
MIRT1028573	hsa-miR-324-5p	CLIP-seq
MIRT1028574	hsa-miR-421	CLIP-seq
MIRT1028575	hsa-miR-4263	CLIP-seq
MIRT1028576	hsa-miR-4267	CLIP-seq
MIRT1028577	hsa-miR-4436b-3p	CLIP-seq
MIRT1028578	hsa-miR-4502	CLIP-seq
MIRT1028579	hsa-miR-4641	CLIP-seq
MIRT1028580	hsa-miR-4709-5p	CLIP-seq
MIRT1028581	hsa-miR-4721	CLIP-seq
MIRT1028582	hsa-miR-4724-3p	CLIP-seq
MIRT1028583	hsa-miR-4761-3p	CLIP-seq
MIRT1028584	hsa-miR-874	CLIP-seq
MIRT1028585	hsa-miR-875-5p	CLIP-seq
MIRT2005156	hsa-miR-4684-5p	CLIP-seq
MIRT1028568	hsa-miR-2355-5p	CLIP-seq
MIRT1028569	hsa-miR-3127-3p	CLIP-seq
MIRT2388609	hsa-miR-4431	CLIP-seq

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	29162697
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007224	Process	Smoothened signaling pathway	IBA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA
GO:0098552	Component	Side of membrane	IEA
GO:1905475	Process	Regulation of protein localization to membrane	IBA

MIM	HGNC	e!Ensembl
618446	4450	ENSG00000213420

Q8N158

Protein name

Glypican-2 [Cleaved into: Secreted glypican-2]

Protein function

Cell surface proteoglycan that bears heparan sulfate. May fulfill a function related to the motile behaviors of developing neurons (By similarity).

PDB

6WJL , 7T62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01153	Glypican	11 → 566	Glypican	Family

Sequence

MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQH
SLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHP
QYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSE
ALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGL
LILADKLQGPFSFELTAESIGVKISEGLMYLQENSAKVSAQVFQECGPPDPVPARNRRAP
PPREEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMAA
DASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATAR
MKTAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGG
GGSARYNQGRSRSGGASIGFHTQTILILSLSALALLGPR

Sequence length

579

Interactions

View interactions

Reactome Pathway
A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
GPC6	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	[]
GPC4	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	[]
GPC5	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	[]
GPC3	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	[]
AGRN	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	[]

GPC2 (glypican 2)

Bookmark This Gene