GPC5 (glypican 5)

Gene

• Entrez ID: 2262
• Gene name: Glypican 5
• Gene symbol: GPC5
• Synonyms (NCBI Gene): -
• Chromosome: 13
• Chromosome location: 13q31.3
• Summary: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438314	hsa-miR-217	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26098560
MIRT438314	hsa-miR-217	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26098560
MIRT438314	hsa-miR-217	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26098560
MIRT438314	hsa-miR-217	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26098560
MIRT657706	hsa-miR-548ac	HITS-CLIP	23824327
MIRT657705	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT657704	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT657703	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT657702	hsa-miR-548z	HITS-CLIP	23824327
MIRT449572	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT449571	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT449570	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT449569	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT449568	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT449567	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT449566	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT657701	hsa-miR-4637	HITS-CLIP	23824327
MIRT657700	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT657699	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT657697	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT657698	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT657696	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT657695	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625752	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625759	hsa-miR-1470	HITS-CLIP	23824327
MIRT625758	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625756	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT625755	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT625754	hsa-miR-4469	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625750	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT625759	hsa-miR-1470	HITS-CLIP	23824327
MIRT625758	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625756	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT625755	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT625754	hsa-miR-4469	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625752	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625750	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT449572	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT449571	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT449570	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT449569	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT449568	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT449567	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT449566	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT449565	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT449564	hsa-miR-3133	PAR-CLIP	22100165
MIRT449563	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT449562	hsa-miR-20a-3p	PAR-CLIP	22100165
MIRT449561	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT449560	hsa-miR-190b	PAR-CLIP	22100165
MIRT732315	hsa-miR-297	Luciferase reporter assay, qRT-PCR, Western blot	27554041
MIRT732315	hsa-miR-297	Luciferase reporter assay, qRT-PCR, Western blot	27554041
MIRT657706	hsa-miR-548ac	HITS-CLIP	23824327
MIRT657705	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT657704	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT657703	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT657702	hsa-miR-548z	HITS-CLIP	23824327
MIRT449572	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT449571	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT449570	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT449569	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT449568	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT449567	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT449566	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT657701	hsa-miR-4637	HITS-CLIP	23824327
MIRT657700	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT657699	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT657697	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT657698	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT657696	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT657695	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625752	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625759	hsa-miR-1470	HITS-CLIP	23824327
MIRT625758	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625756	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT625755	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT625754	hsa-miR-4469	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625750	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT625759	hsa-miR-1470	HITS-CLIP	23824327
MIRT625758	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625757	hsa-miR-5193	HITS-CLIP	23824327
MIRT625756	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT625755	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT625754	hsa-miR-4469	HITS-CLIP	23824327
MIRT625753	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT625752	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT625751	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625750	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT449572	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT449571	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT449570	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT449569	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT449568	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT449567	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT449566	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT449565	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT449564	hsa-miR-3133	PAR-CLIP	22100165
MIRT449563	hsa-miR-186-5p	PAR-CLIP	22100165
MIRT449562	hsa-miR-20a-3p	PAR-CLIP	22100165
MIRT449561	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT449560	hsa-miR-190b	PAR-CLIP	22100165
MIRT1028608	hsa-miR-1253	CLIP-seq
MIRT1028609	hsa-miR-200b	CLIP-seq
MIRT1028610	hsa-miR-200c	CLIP-seq
MIRT1028611	hsa-miR-2467-3p	CLIP-seq
MIRT1028612	hsa-miR-3653	CLIP-seq
MIRT1028613	hsa-miR-3658	CLIP-seq
MIRT1028614	hsa-miR-3678-3p	CLIP-seq
MIRT1028615	hsa-miR-429	CLIP-seq
MIRT1028616	hsa-miR-4418	CLIP-seq
MIRT1028617	hsa-miR-4436a	CLIP-seq
MIRT1028618	hsa-miR-452	CLIP-seq
MIRT1028619	hsa-miR-4676-3p	CLIP-seq
MIRT1028620	hsa-miR-509-3-5p	CLIP-seq
MIRT1028621	hsa-miR-509-5p	CLIP-seq
MIRT1028622	hsa-miR-548ag	CLIP-seq
MIRT1028623	hsa-miR-548ai	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	30282023, 32814053, 35512704
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7657705
GO:0016477	Process	Cell migration	IBA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0098552	Component	Side of membrane	IEA
GO:1905475	Process	Regulation of protein localization to membrane	IBA

Other IDs

• MIM: 602446
• HGNC: 4453
• e!Ensembl: ENSG00000179399

Protein

• UniProt ID: P78333
• Protein name: Glypican-5 [Cleaved into: Secreted glypican-5]
• Protein function: Cell surface proteoglycan that bears heparan sulfate.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01153	Glypican	12 → 570	Glypican	Family

• Tissue specificity: TISSUE SPECIFICITY: In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver. {ECO:0000269|PubMed:9070915, ECO:0000269|PubMed:9331333}.
• Sequence:

  MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQV
  CISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAEN
  YTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLIN
  PGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTD
  YLHFSKECSRALLKMQYCPHCQGLALTKPCMGYCLNVMRGCLAHMAELNPHWHAYIRSLE
  ELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSF
  DQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWN
  GEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWE
  LLQLGSGGGMVEQVSGDCDDEDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTG
  STLDTTGAGCAVATESMTFTLISVVMLLPGIW

• Sequence length: 572

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GPC5-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC INTRADUCTAL PAPILLARY-MUCINOUS NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	BEFREE	16596674		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20304703, 24682381, 27157618, 27554041, 27806326		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	30414409		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29407175		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30423114	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32970968	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26399219	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25818666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20304703, 22236185, 24456789, 25999661, 27157618, 27806326		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26399219	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33302876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26399219		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20085586	Associate	★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	19022413		★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	BEFREE	16596674		★☆☆☆☆ Found in Text Mining only
Contiguous gene syndrome	Contiguous gene syndrome	BEFREE	19022413		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	24135429		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25987249, 31209190		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31209190		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26399219		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	27862604		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30951720		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	25978455		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25818666		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20304703, 25999661, 36165234	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26631038	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12721791		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12721791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20304703, 22236185, 24456789, 25999661, 27157618, 27806326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30578891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28893348		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31004080	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	19010793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	19010793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	19010793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19556317, 19865102, 20692050, 20944657, 24135429, 24943672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19865102, 32398079	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12721791, 17210683, 23962560, 24682381, 27157618, 28893348, 29407175, 30578891, 30951720		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	21441931, 30414409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	GWASCAT_DG	21441931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	CTD_human_DG	21441931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30414409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	BEFREE	23223018		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	24135429		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23962560		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30578891		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29407175		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28893348		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26631038	Associate	★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21441931, 25987249		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17210683, 24412155		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	25978455		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	30414409		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	27806326		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	19941983		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	23223018		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25935541	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26098560	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35183057	Inhibit	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	GWASDB_DG	23297363		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	GWASCAT_DG	23297363		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	23297363	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	27862604	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37410084	Associate	★☆☆☆☆ Found in Text Mining only