Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10082
Gene name	Glypican 6
Gene symbol	GPC6
Synonyms (NCBI Gene)	OMIMD1
Chromosome	13
Chromosome location	13q31.3-q32.1
Summary	The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor

SNP ID	Visualize variation	Clinical significance	Consequence
rs863223282	C>-	Pathogenic	Genic upstream transcript variant, coding sequence variant, frameshift variant

350 Show/Hide all (350)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044098	hsa-miR-361-5p	CLASH	23622248
MIRT537100	hsa-miR-548u	PAR-CLIP	22012620
MIRT537099	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT537098	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT537097	hsa-miR-483-5p	PAR-CLIP	22012620
MIRT537096	hsa-miR-1279	PAR-CLIP	22012620
MIRT537100	hsa-miR-548u	PAR-CLIP	22012620
MIRT537099	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT537098	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT537097	hsa-miR-483-5p	PAR-CLIP	22012620
MIRT537096	hsa-miR-1279	PAR-CLIP	22012620
MIRT1028624	hsa-miR-141	CLIP-seq
MIRT1028625	hsa-miR-186	CLIP-seq
MIRT1028626	hsa-miR-200a	CLIP-seq
MIRT1028627	hsa-miR-219-1-3p	CLIP-seq
MIRT1028628	hsa-miR-25	CLIP-seq
MIRT1028629	hsa-miR-28-3p	CLIP-seq
MIRT1028630	hsa-miR-3133	CLIP-seq
MIRT1028631	hsa-miR-3148	CLIP-seq
MIRT1028632	hsa-miR-3149	CLIP-seq
MIRT1028633	hsa-miR-32	CLIP-seq
MIRT1028634	hsa-miR-3617	CLIP-seq
MIRT1028635	hsa-miR-363	CLIP-seq
MIRT1028636	hsa-miR-367	CLIP-seq
MIRT1028637	hsa-miR-3910	CLIP-seq
MIRT1028638	hsa-miR-3925-3p	CLIP-seq
MIRT1028639	hsa-miR-4257	CLIP-seq
MIRT1028640	hsa-miR-451b	CLIP-seq
MIRT1028641	hsa-miR-4682	CLIP-seq
MIRT1028642	hsa-miR-4775	CLIP-seq
MIRT1028643	hsa-miR-4793-5p	CLIP-seq
MIRT1028644	hsa-miR-4794	CLIP-seq
MIRT1028645	hsa-miR-515-5p	CLIP-seq
MIRT1028646	hsa-miR-571	CLIP-seq
MIRT1028647	hsa-miR-641	CLIP-seq
MIRT1028648	hsa-miR-766	CLIP-seq
MIRT1028649	hsa-miR-892b	CLIP-seq
MIRT1028650	hsa-miR-92a	CLIP-seq
MIRT1028651	hsa-miR-92b	CLIP-seq
MIRT2005167	hsa-miR-125a-5p	CLIP-seq
MIRT2005168	hsa-miR-125b	CLIP-seq
MIRT2005169	hsa-miR-3123	CLIP-seq
MIRT2005170	hsa-miR-338-5p	CLIP-seq
MIRT2005171	hsa-miR-3653	CLIP-seq
MIRT2005172	hsa-miR-3658	CLIP-seq
MIRT2005173	hsa-miR-3673	CLIP-seq
MIRT2005174	hsa-miR-3925-5p	CLIP-seq
MIRT2005175	hsa-miR-4319	CLIP-seq
MIRT2005176	hsa-miR-4453	CLIP-seq
MIRT2005177	hsa-miR-4474-5p	CLIP-seq
MIRT2005178	hsa-miR-4538	CLIP-seq
MIRT2237805	hsa-miR-188-5p	CLIP-seq
MIRT2237806	hsa-miR-219-2-3p	CLIP-seq
MIRT2237807	hsa-miR-2964a-3p	CLIP-seq
MIRT2237808	hsa-miR-3163	CLIP-seq
MIRT2237809	hsa-miR-3915	CLIP-seq
MIRT2237810	hsa-miR-3928	CLIP-seq
MIRT2237811	hsa-miR-4276	CLIP-seq
MIRT2237812	hsa-miR-431	CLIP-seq
MIRT2237813	hsa-miR-513a-3p	CLIP-seq
MIRT2237814	hsa-miR-556-5p	CLIP-seq
MIRT2237815	hsa-miR-595	CLIP-seq
MIRT2541832	hsa-miR-1236	CLIP-seq
MIRT2541833	hsa-miR-1254	CLIP-seq
MIRT2541834	hsa-miR-129-5p	CLIP-seq
MIRT2541835	hsa-miR-1298	CLIP-seq
MIRT2541836	hsa-miR-1305	CLIP-seq
MIRT2541837	hsa-miR-1321	CLIP-seq
MIRT1028624	hsa-miR-141	CLIP-seq
MIRT2541838	hsa-miR-149	CLIP-seq
MIRT2541839	hsa-miR-1827	CLIP-seq
MIRT1028625	hsa-miR-186	CLIP-seq
MIRT1028626	hsa-miR-200a	CLIP-seq
MIRT2541840	hsa-miR-205	CLIP-seq
MIRT2541841	hsa-miR-2054	CLIP-seq
MIRT2541842	hsa-miR-224	CLIP-seq
MIRT2541843	hsa-miR-2355-3p	CLIP-seq
MIRT2541844	hsa-miR-24	CLIP-seq
MIRT2541845	hsa-miR-300	CLIP-seq
MIRT2541846	hsa-miR-3064-3p	CLIP-seq
MIRT2541847	hsa-miR-3116	CLIP-seq
MIRT2541848	hsa-miR-3121-3p	CLIP-seq
MIRT2541849	hsa-miR-3122	CLIP-seq
MIRT2541850	hsa-miR-3129-3p	CLIP-seq
MIRT1028630	hsa-miR-3133	CLIP-seq
MIRT2541851	hsa-miR-3140-3p	CLIP-seq
MIRT2541852	hsa-miR-3146	CLIP-seq
MIRT2541853	hsa-miR-3153	CLIP-seq
MIRT2541854	hsa-miR-323b-5p	CLIP-seq
MIRT2541855	hsa-miR-33a	CLIP-seq
MIRT2541856	hsa-miR-33b	CLIP-seq
MIRT2541857	hsa-miR-34c-3p	CLIP-seq
MIRT2541858	hsa-miR-3612	CLIP-seq
MIRT2541859	hsa-miR-3646	CLIP-seq
MIRT2541860	hsa-miR-3647-3p	CLIP-seq
MIRT2541861	hsa-miR-3662	CLIP-seq
MIRT2541862	hsa-miR-3664-3p	CLIP-seq
MIRT2541863	hsa-miR-369-3p	CLIP-seq
MIRT2541864	hsa-miR-374a	CLIP-seq
MIRT2541865	hsa-miR-374b	CLIP-seq
MIRT2541866	hsa-miR-376a	CLIP-seq
MIRT2541867	hsa-miR-376b	CLIP-seq
MIRT2541868	hsa-miR-381	CLIP-seq
MIRT2541869	hsa-miR-3913-3p	CLIP-seq
MIRT2541870	hsa-miR-3913-5p	CLIP-seq
MIRT2541871	hsa-miR-3973	CLIP-seq
MIRT2541872	hsa-miR-4275	CLIP-seq
MIRT2541873	hsa-miR-4284	CLIP-seq
MIRT2541874	hsa-miR-4289	CLIP-seq
MIRT2541875	hsa-miR-4423-3p	CLIP-seq
MIRT2541876	hsa-miR-4473	CLIP-seq
MIRT2541877	hsa-miR-4475	CLIP-seq
MIRT2541878	hsa-miR-4504	CLIP-seq
MIRT2541879	hsa-miR-4517	CLIP-seq
MIRT2541880	hsa-miR-4528	CLIP-seq
MIRT2541881	hsa-miR-4539	CLIP-seq
MIRT2541882	hsa-miR-4652-3p	CLIP-seq
MIRT2541883	hsa-miR-4668-5p	CLIP-seq
MIRT2541884	hsa-miR-4690-5p	CLIP-seq
MIRT2541885	hsa-miR-4711-5p	CLIP-seq
MIRT2541886	hsa-miR-4728-3p	CLIP-seq
MIRT2541887	hsa-miR-4729	CLIP-seq
MIRT2541888	hsa-miR-4739	CLIP-seq
MIRT2541889	hsa-miR-4744	CLIP-seq
MIRT2541890	hsa-miR-4756-5p	CLIP-seq
MIRT2541891	hsa-miR-4760-3p	CLIP-seq
MIRT2541892	hsa-miR-4768-5p	CLIP-seq
MIRT2541893	hsa-miR-4789-3p	CLIP-seq
MIRT1028643	hsa-miR-4793-5p	CLIP-seq
MIRT2541894	hsa-miR-489	CLIP-seq
MIRT2541895	hsa-miR-491-3p	CLIP-seq
MIRT2541896	hsa-miR-493	CLIP-seq
MIRT2541897	hsa-miR-494	CLIP-seq
MIRT2541898	hsa-miR-510	CLIP-seq
MIRT2541899	hsa-miR-512-3p	CLIP-seq
MIRT2237813	hsa-miR-513a-3p	CLIP-seq
MIRT2541900	hsa-miR-520d-5p	CLIP-seq
MIRT2541901	hsa-miR-520f	CLIP-seq
MIRT2541902	hsa-miR-524-5p	CLIP-seq
MIRT2541903	hsa-miR-542-3p	CLIP-seq
MIRT2541904	hsa-miR-548a-5p	CLIP-seq
MIRT2541905	hsa-miR-548ab	CLIP-seq
MIRT2541906	hsa-miR-548ak	CLIP-seq
MIRT2541907	hsa-miR-548b-5p	CLIP-seq
MIRT2541908	hsa-miR-548c-3p	CLIP-seq
MIRT2541909	hsa-miR-548c-5p	CLIP-seq
MIRT2541910	hsa-miR-548d-5p	CLIP-seq
MIRT2541911	hsa-miR-548h	CLIP-seq
MIRT2541912	hsa-miR-548i	CLIP-seq
MIRT2541913	hsa-miR-548j	CLIP-seq
MIRT2541914	hsa-miR-548l	CLIP-seq
MIRT2541915	hsa-miR-548w	CLIP-seq
MIRT2541916	hsa-miR-548y	CLIP-seq
MIRT2541917	hsa-miR-559	CLIP-seq
MIRT2541918	hsa-miR-561	CLIP-seq
MIRT2541919	hsa-miR-570	CLIP-seq
MIRT2541920	hsa-miR-579	CLIP-seq
MIRT2541921	hsa-miR-582-5p	CLIP-seq
MIRT2541922	hsa-miR-586	CLIP-seq
MIRT2541923	hsa-miR-600	CLIP-seq
MIRT2541924	hsa-miR-616	CLIP-seq
MIRT2541925	hsa-miR-621	CLIP-seq
MIRT2541926	hsa-miR-642b	CLIP-seq
MIRT2541927	hsa-miR-650	CLIP-seq
MIRT2541928	hsa-miR-653	CLIP-seq
MIRT2541929	hsa-miR-656	CLIP-seq
MIRT2541930	hsa-miR-661	CLIP-seq
MIRT2541931	hsa-miR-664	CLIP-seq
MIRT2541932	hsa-miR-676	CLIP-seq
MIRT2541933	hsa-miR-873	CLIP-seq
MIRT2541934	hsa-miR-9	CLIP-seq
MIRT2541935	hsa-miR-942	CLIP-seq
MIRT2681899	hsa-miR-106a	CLIP-seq
MIRT2681900	hsa-miR-106b	CLIP-seq
MIRT2541833	hsa-miR-1254	CLIP-seq
MIRT2541834	hsa-miR-129-5p	CLIP-seq
MIRT2681901	hsa-miR-1296	CLIP-seq
MIRT2541835	hsa-miR-1298	CLIP-seq
MIRT2541837	hsa-miR-1321	CLIP-seq
MIRT1028624	hsa-miR-141	CLIP-seq
MIRT2681902	hsa-miR-142-5p	CLIP-seq
MIRT2541838	hsa-miR-149	CLIP-seq
MIRT2681903	hsa-miR-1538	CLIP-seq
MIRT2681904	hsa-miR-154	CLIP-seq
MIRT2681905	hsa-miR-17	CLIP-seq
MIRT2541839	hsa-miR-1827	CLIP-seq
MIRT1028626	hsa-miR-200a	CLIP-seq
MIRT2681906	hsa-miR-203	CLIP-seq
MIRT2541840	hsa-miR-205	CLIP-seq
MIRT2681907	hsa-miR-2052	CLIP-seq
MIRT2541841	hsa-miR-2054	CLIP-seq
MIRT2681908	hsa-miR-20a	CLIP-seq
MIRT2681909	hsa-miR-20b	CLIP-seq
MIRT1028627	hsa-miR-219-1-3p	CLIP-seq
MIRT2541842	hsa-miR-224	CLIP-seq
MIRT2541843	hsa-miR-2355-3p	CLIP-seq
MIRT2541844	hsa-miR-24	CLIP-seq
MIRT2681910	hsa-miR-2909	CLIP-seq
MIRT2541845	hsa-miR-300	CLIP-seq
MIRT2681911	hsa-miR-302a	CLIP-seq
MIRT2681912	hsa-miR-302b	CLIP-seq
MIRT2681913	hsa-miR-302c	CLIP-seq
MIRT2681914	hsa-miR-302d	CLIP-seq
MIRT2681915	hsa-miR-302e	CLIP-seq
MIRT2541846	hsa-miR-3064-3p	CLIP-seq
MIRT2541847	hsa-miR-3116	CLIP-seq
MIRT2681916	hsa-miR-3120-5p	CLIP-seq
MIRT2541848	hsa-miR-3121-3p	CLIP-seq
MIRT2541849	hsa-miR-3122	CLIP-seq
MIRT2541850	hsa-miR-3129-3p	CLIP-seq
MIRT2541851	hsa-miR-3140-3p	CLIP-seq
MIRT2541852	hsa-miR-3146	CLIP-seq
MIRT2541853	hsa-miR-3153	CLIP-seq
MIRT2681917	hsa-miR-3161	CLIP-seq
MIRT2681918	hsa-miR-3170	CLIP-seq
MIRT2541854	hsa-miR-323b-5p	CLIP-seq
MIRT2681919	hsa-miR-328	CLIP-seq
MIRT2541855	hsa-miR-33a	CLIP-seq
MIRT2541856	hsa-miR-33b	CLIP-seq
MIRT2541857	hsa-miR-34c-3p	CLIP-seq
MIRT2541858	hsa-miR-3612	CLIP-seq
MIRT1028634	hsa-miR-3617	CLIP-seq
MIRT2541859	hsa-miR-3646	CLIP-seq
MIRT2541860	hsa-miR-3647-3p	CLIP-seq
MIRT2005171	hsa-miR-3653	CLIP-seq
MIRT2005172	hsa-miR-3658	CLIP-seq
MIRT2541861	hsa-miR-3662	CLIP-seq
MIRT2681920	hsa-miR-3663-3p	CLIP-seq
MIRT2541862	hsa-miR-3664-3p	CLIP-seq
MIRT2681921	hsa-miR-3689a-3p	CLIP-seq
MIRT2681922	hsa-miR-3689c	CLIP-seq
MIRT2541863	hsa-miR-369-3p	CLIP-seq
MIRT2681923	hsa-miR-372	CLIP-seq
MIRT2681924	hsa-miR-373	CLIP-seq
MIRT2541864	hsa-miR-374a	CLIP-seq
MIRT2541865	hsa-miR-374b	CLIP-seq
MIRT2541868	hsa-miR-381	CLIP-seq
MIRT2681925	hsa-miR-3908	CLIP-seq
MIRT2541869	hsa-miR-3913-3p	CLIP-seq
MIRT2541870	hsa-miR-3913-5p	CLIP-seq
MIRT2681926	hsa-miR-3926	CLIP-seq
MIRT2681927	hsa-miR-3942-5p	CLIP-seq
MIRT2541871	hsa-miR-3973	CLIP-seq
MIRT2681928	hsa-miR-409-3p	CLIP-seq
MIRT1028639	hsa-miR-4257	CLIP-seq
MIRT2541872	hsa-miR-4275	CLIP-seq
MIRT2541873	hsa-miR-4284	CLIP-seq
MIRT2541874	hsa-miR-4289	CLIP-seq
MIRT2237812	hsa-miR-431	CLIP-seq
MIRT2541875	hsa-miR-4423-3p	CLIP-seq
MIRT2541876	hsa-miR-4473	CLIP-seq
MIRT2541877	hsa-miR-4475	CLIP-seq
MIRT2541878	hsa-miR-4504	CLIP-seq
MIRT2681929	hsa-miR-4512	CLIP-seq
MIRT2541879	hsa-miR-4517	CLIP-seq
MIRT2541880	hsa-miR-4528	CLIP-seq
MIRT2541881	hsa-miR-4539	CLIP-seq
MIRT2541882	hsa-miR-4652-3p	CLIP-seq
MIRT2681930	hsa-miR-4659a-3p	CLIP-seq
MIRT2681931	hsa-miR-4659b-3p	CLIP-seq
MIRT2541883	hsa-miR-4668-5p	CLIP-seq
MIRT1028641	hsa-miR-4682	CLIP-seq
MIRT2681932	hsa-miR-4688	CLIP-seq
MIRT2541884	hsa-miR-4690-5p	CLIP-seq
MIRT2681933	hsa-miR-4703-5p	CLIP-seq
MIRT2541885	hsa-miR-4711-5p	CLIP-seq
MIRT2541886	hsa-miR-4728-3p	CLIP-seq
MIRT2681934	hsa-miR-4728-5p	CLIP-seq
MIRT2541887	hsa-miR-4729	CLIP-seq
MIRT2681935	hsa-miR-4735-5p	CLIP-seq
MIRT2541888	hsa-miR-4739	CLIP-seq
MIRT2541889	hsa-miR-4744	CLIP-seq
MIRT2681936	hsa-miR-4745-3p	CLIP-seq
MIRT2541890	hsa-miR-4756-5p	CLIP-seq
MIRT2541891	hsa-miR-4760-3p	CLIP-seq
MIRT2681937	hsa-miR-4766-3p	CLIP-seq
MIRT2541892	hsa-miR-4768-5p	CLIP-seq
MIRT2541893	hsa-miR-4789-3p	CLIP-seq
MIRT1028643	hsa-miR-4793-5p	CLIP-seq
MIRT2681938	hsa-miR-486-3p	CLIP-seq
MIRT2541894	hsa-miR-489	CLIP-seq
MIRT2541895	hsa-miR-491-3p	CLIP-seq
MIRT2541896	hsa-miR-493	CLIP-seq
MIRT2541897	hsa-miR-494	CLIP-seq
MIRT2681939	hsa-miR-500a	CLIP-seq
MIRT2681940	hsa-miR-501-5p	CLIP-seq
MIRT2541898	hsa-miR-510	CLIP-seq
MIRT2541899	hsa-miR-512-3p	CLIP-seq
MIRT2237813	hsa-miR-513a-3p	CLIP-seq
MIRT2681941	hsa-miR-518a-5p	CLIP-seq
MIRT2681942	hsa-miR-519d	CLIP-seq
MIRT2681943	hsa-miR-520a-3p	CLIP-seq
MIRT2681944	hsa-miR-520b	CLIP-seq
MIRT2681945	hsa-miR-520c-3p	CLIP-seq
MIRT2681946	hsa-miR-520d-3p	CLIP-seq
MIRT2541900	hsa-miR-520d-5p	CLIP-seq
MIRT2681947	hsa-miR-520e	CLIP-seq
MIRT2541901	hsa-miR-520f	CLIP-seq
MIRT2681948	hsa-miR-520g	CLIP-seq
MIRT2681949	hsa-miR-520h	CLIP-seq
MIRT2541902	hsa-miR-524-5p	CLIP-seq
MIRT2681950	hsa-miR-527	CLIP-seq
MIRT2541903	hsa-miR-542-3p	CLIP-seq
MIRT2541904	hsa-miR-548a-5p	CLIP-seq
MIRT2541905	hsa-miR-548ab	CLIP-seq
MIRT2681951	hsa-miR-548ae	CLIP-seq
MIRT2681952	hsa-miR-548aj	CLIP-seq
MIRT2541906	hsa-miR-548ak	CLIP-seq
MIRT2681953	hsa-miR-548am	CLIP-seq
MIRT2541907	hsa-miR-548b-5p	CLIP-seq
MIRT2541908	hsa-miR-548c-3p	CLIP-seq
MIRT2541909	hsa-miR-548c-5p	CLIP-seq
MIRT2541910	hsa-miR-548d-5p	CLIP-seq
MIRT2541911	hsa-miR-548h	CLIP-seq
MIRT2541912	hsa-miR-548i	CLIP-seq
MIRT2541913	hsa-miR-548j	CLIP-seq
MIRT2681954	hsa-miR-548k	CLIP-seq
MIRT2541914	hsa-miR-548l	CLIP-seq
MIRT2681955	hsa-miR-548t	CLIP-seq
MIRT2541915	hsa-miR-548w	CLIP-seq
MIRT2681956	hsa-miR-548x	CLIP-seq
MIRT2541916	hsa-miR-548y	CLIP-seq
MIRT2541917	hsa-miR-559	CLIP-seq
MIRT2541918	hsa-miR-561	CLIP-seq
MIRT2681957	hsa-miR-562	CLIP-seq
MIRT2541919	hsa-miR-570	CLIP-seq
MIRT1028646	hsa-miR-571	CLIP-seq
MIRT2541920	hsa-miR-579	CLIP-seq
MIRT2541921	hsa-miR-582-5p	CLIP-seq
MIRT2541922	hsa-miR-586	CLIP-seq
MIRT2237815	hsa-miR-595	CLIP-seq
MIRT2541923	hsa-miR-600	CLIP-seq
MIRT2541924	hsa-miR-616	CLIP-seq
MIRT2541925	hsa-miR-621	CLIP-seq
MIRT2681958	hsa-miR-626	CLIP-seq
MIRT2681959	hsa-miR-635	CLIP-seq
MIRT1028647	hsa-miR-641	CLIP-seq
MIRT2541926	hsa-miR-642b	CLIP-seq
MIRT2541927	hsa-miR-650	CLIP-seq
MIRT2541928	hsa-miR-653	CLIP-seq
MIRT2541929	hsa-miR-656	CLIP-seq
MIRT2541930	hsa-miR-661	CLIP-seq
MIRT2541931	hsa-miR-664	CLIP-seq
MIRT2541932	hsa-miR-676	CLIP-seq
MIRT2541933	hsa-miR-873	CLIP-seq
MIRT2681960	hsa-miR-885-5p	CLIP-seq
MIRT2681961	hsa-miR-892a	CLIP-seq
MIRT2541934	hsa-miR-9	CLIP-seq
MIRT2681962	hsa-miR-93	CLIP-seq
MIRT2541935	hsa-miR-942	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 29162697, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0015026	Function	Coreceptor activity	NAS	24431302
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	21871017
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IBA

MIM	HGNC	e!Ensembl
604404	4454	ENSG00000183098

Q9Y625

Protein name

Glypican-6 [Cleaved into: Secreted glypican-6]

Protein function

Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity). Enhances migration and invasion of cancer cells through WNT5A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01153	Glypican	13 → 554	Glypican	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High expression in fetal kidney and lung and lower expressions in fetal liver and brain. In adult tissues, very abundant in ovary, high levels also observed in liver, kidney, small intestine and colon. Not detected in

Sequence

MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRIC
PQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSL
NDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQY
HFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSP
TPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAE
RLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENF
NTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEE
ECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNG
NDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLS
WSLTCIVLALQRLCR

Sequence length

555

Interactions

View interactions

Reactome Pathway
A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal recessive omodysplasia	Pathogenic	rs863223282, rs121908440	RCV000005888 RCV000005891	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (36)
ALZHEIMER DISEASE	—	GWAS catalog	23535033, 33074286, 38958117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	18839057	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	20889312	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	19481194	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GPC6-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	34343768, 35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	38958117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMB DEFORMITIES, CONGENITAL	—	CTD, Disgenet CTD, Disgenet	19481194	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30643256, 37464041	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	20889312	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASE	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	20634892, 30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	32766473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Omodysplasia	Likely benign; Uncertain significance; Benign	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OMODYSPLASIA 1	—	HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OMODYSPLASIA TYPE 1	—	CTD, Disgenet CTD, Disgenet	19481194	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	28869591	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	26545240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	24554482	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	20889312, 26198764	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256, 39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (69)
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	18839057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	18839057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive omodysplasia	Omodysplasia	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Developmental	Bone disease	Pubtator	30982611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	30982611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21871017		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GPC4	1	["Craniofacial abnormalities"]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	2	["CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)"]
GPC2	0	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	0	[]
GPC5	0	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	1	["GWAS catalog (Nonalcoholic fatty liver disease)"]
GPC3	0	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	0	[]
AGRN	0	[]	9	["A tetrasaccharide linker sequence is required for GAG synthesis","HS-GAG biosynthesis","HS-GAG degradation","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective EXT2 causes exostoses 2","Defective EXT1 causes exostoses 1, TRPS2 and CHDS","Defective B3GALT6 causes EDSP2 and SEMDJL1","Retinoid metabolism and transport"]	0	[]

GPC6 (glypican 6)

Bookmark This Gene