Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	122706
Gene name	Proteasome subunit beta 11
Gene symbol	PSMB11
Synonyms (NCBI Gene)	BETA5T
Chromosome	14
Chromosome location	14q11.2
Summary	Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric

44 Show/Hide all (44)

miRTarBase ID	miRNA	Experiments
MIRT1270080	hsa-miR-3617	CLIP-seq
MIRT1270081	hsa-miR-4252	CLIP-seq
MIRT1270082	hsa-miR-4311	CLIP-seq
MIRT1270083	hsa-miR-4318	CLIP-seq
MIRT1270084	hsa-miR-4693-5p	CLIP-seq
MIRT1270085	hsa-miR-4722-3p	CLIP-seq
MIRT1270086	hsa-miR-4725-5p	CLIP-seq
MIRT1270087	hsa-miR-4777-3p	CLIP-seq
MIRT1270088	hsa-miR-504	CLIP-seq
MIRT1270089	hsa-miR-641	CLIP-seq
MIRT1270090	hsa-miR-892a	CLIP-seq
MIRT2079431	hsa-miR-596	CLIP-seq
MIRT2079432	hsa-miR-642a	CLIP-seq
MIRT2079433	hsa-miR-671-5p	CLIP-seq
MIRT2305689	hsa-miR-127-5p	CLIP-seq
MIRT2305690	hsa-miR-143	CLIP-seq
MIRT2305691	hsa-miR-3134	CLIP-seq
MIRT2305692	hsa-miR-3148	CLIP-seq
MIRT2305693	hsa-miR-3688-3p	CLIP-seq
MIRT2305694	hsa-miR-3919	CLIP-seq
MIRT2305695	hsa-miR-4329	CLIP-seq
MIRT2305696	hsa-miR-4534	CLIP-seq
MIRT2305697	hsa-miR-4770	CLIP-seq
MIRT2305698	hsa-miR-4789-3p	CLIP-seq
MIRT2305699	hsa-miR-642b	CLIP-seq
MIRT2457328	hsa-miR-1275	CLIP-seq
MIRT2457329	hsa-miR-1587	CLIP-seq
MIRT2457330	hsa-miR-3151	CLIP-seq
MIRT2457331	hsa-miR-4417	CLIP-seq
MIRT2457332	hsa-miR-4447	CLIP-seq
MIRT2457333	hsa-miR-4472	CLIP-seq
MIRT2457334	hsa-miR-4492	CLIP-seq
MIRT2457335	hsa-miR-4498	CLIP-seq
MIRT2457336	hsa-miR-4525	CLIP-seq
MIRT2457337	hsa-miR-4656	CLIP-seq
MIRT2457338	hsa-miR-4665-5p	CLIP-seq
MIRT2457339	hsa-miR-4675	CLIP-seq
MIRT2457340	hsa-miR-4723-5p	CLIP-seq
MIRT2457341	hsa-miR-4741	CLIP-seq
MIRT2457342	hsa-miR-491-5p	CLIP-seq
MIRT2457343	hsa-miR-541	CLIP-seq
MIRT2457344	hsa-miR-625	CLIP-seq
MIRT2457345	hsa-miR-654-5p	CLIP-seq
MIRT2457346	hsa-miR-762	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IEA
GO:0006508	Process	Proteolysis	IDA	17540904
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	17540904
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	IBA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA

MIM	HGNC	e!Ensembl
611137	31963	ENSG00000222028

A5LHX3

Protein name

Proteasome subunit beta type-11 (EC 3.4.25.1) (Proteasome subunit beta-5t)

Protein function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent pr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	46 → 228	Proteasome subunit	Domain

Sequence

MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHG
VIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREG
QLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSG
SPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSD
ACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV

Sequence length

300

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
	Cross-presentation of soluble exogenous antigens (endosomes)
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSME4	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
PSMA8	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
PSMB9	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
PSMB10	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]
PSMF1	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	[]

PSMB11 (proteasome subunit beta 11)

Bookmark This Gene