PSME4 (proteasome activator subunit 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23198
• Gene name: Proteasome activator subunit 4
• Gene symbol: PSME4
• Synonyms (NCBI Gene): Blm10, PA200, hBlm10
• Chromosome: 2
• Chromosome location: 2p16.2

miRNA Show/Hide all (319)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019934	hsa-miR-375	Microarray	20215506
MIRT020902	hsa-miR-155-5p	Proteomics	18668040
MIRT027763	hsa-miR-98-5p	Microarray	19088304
MIRT028604	hsa-miR-30a-5p	Proteomics	18668040
MIRT031835	hsa-miR-16-5p	Proteomics	18668040
MIRT051708	hsa-let-7e-5p	CLASH	23622248
MIRT035894	hsa-miR-1303	CLASH	23622248
MIRT716831	hsa-miR-651-3p	HITS-CLIP	19536157
MIRT716830	hsa-miR-1183	HITS-CLIP	19536157
MIRT716829	hsa-miR-4255	HITS-CLIP	19536157
MIRT716828	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT716827	hsa-miR-6073	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716826	hsa-miR-4326	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716824	hsa-miR-4477b	HITS-CLIP	19536157
MIRT716823	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT716831	hsa-miR-651-3p	HITS-CLIP	19536157
MIRT716830	hsa-miR-1183	HITS-CLIP	19536157
MIRT716829	hsa-miR-4255	HITS-CLIP	19536157
MIRT716828	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT716827	hsa-miR-6073	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716826	hsa-miR-4326	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716824	hsa-miR-4477b	HITS-CLIP	19536157
MIRT716823	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT439882	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439882	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT716831	hsa-miR-651-3p	HITS-CLIP	19536157
MIRT716830	hsa-miR-1183	HITS-CLIP	19536157
MIRT716829	hsa-miR-4255	HITS-CLIP	19536157
MIRT716828	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT716827	hsa-miR-6073	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716826	hsa-miR-4326	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716824	hsa-miR-4477b	HITS-CLIP	19536157
MIRT716823	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT716831	hsa-miR-651-3p	HITS-CLIP	19536157
MIRT716830	hsa-miR-1183	HITS-CLIP	19536157
MIRT716829	hsa-miR-4255	HITS-CLIP	19536157
MIRT716828	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT716827	hsa-miR-6073	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716826	hsa-miR-4326	HITS-CLIP	19536157
MIRT716825	hsa-miR-142-3p	HITS-CLIP	19536157
MIRT716824	hsa-miR-4477b	HITS-CLIP	19536157
MIRT716823	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT1270918	hsa-miR-105	CLIP-seq
MIRT1270919	hsa-miR-1273f	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT1270921	hsa-miR-143	CLIP-seq
MIRT1270922	hsa-miR-203	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT1270924	hsa-miR-3136-3p	CLIP-seq
MIRT1270925	hsa-miR-3153	CLIP-seq
MIRT1270926	hsa-miR-3663-5p	CLIP-seq
MIRT1270927	hsa-miR-3672	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT1270929	hsa-miR-377	CLIP-seq
MIRT1270930	hsa-miR-4251	CLIP-seq
MIRT1270931	hsa-miR-4259	CLIP-seq
MIRT1270932	hsa-miR-4303	CLIP-seq
MIRT1270933	hsa-miR-432	CLIP-seq
MIRT1270934	hsa-miR-4329	CLIP-seq
MIRT1270935	hsa-miR-4425	CLIP-seq
MIRT1270936	hsa-miR-4470	CLIP-seq
MIRT1270937	hsa-miR-4522	CLIP-seq
MIRT1270938	hsa-miR-4639-3p	CLIP-seq
MIRT1270939	hsa-miR-4659a-5p	CLIP-seq
MIRT1270940	hsa-miR-4659b-5p	CLIP-seq
MIRT1270941	hsa-miR-4668-3p	CLIP-seq
MIRT1270942	hsa-miR-4668-5p	CLIP-seq
MIRT1270943	hsa-miR-4700-3p	CLIP-seq
MIRT1270944	hsa-miR-4708-5p	CLIP-seq
MIRT1270945	hsa-miR-4742-3p	CLIP-seq
MIRT1270946	hsa-miR-4770	CLIP-seq
MIRT1270947	hsa-miR-492	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT1270949	hsa-miR-519a	CLIP-seq
MIRT1270950	hsa-miR-519b-3p	CLIP-seq
MIRT1270951	hsa-miR-519c-3p	CLIP-seq
MIRT1270952	hsa-miR-520d-5p	CLIP-seq
MIRT1270953	hsa-miR-524-5p	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT1270957	hsa-miR-556-3p	CLIP-seq
MIRT2079692	hsa-miR-1272	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT2079693	hsa-miR-214	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT2079694	hsa-miR-3182	CLIP-seq
MIRT2079695	hsa-miR-338-3p	CLIP-seq
MIRT2079696	hsa-miR-3619-5p	CLIP-seq
MIRT2079697	hsa-miR-3662	CLIP-seq
MIRT1270926	hsa-miR-3663-5p	CLIP-seq
MIRT2079698	hsa-miR-3667-3p	CLIP-seq
MIRT2079699	hsa-miR-3670	CLIP-seq
MIRT1270927	hsa-miR-3672	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT1270929	hsa-miR-377	CLIP-seq
MIRT2079700	hsa-miR-3922-5p	CLIP-seq
MIRT2079701	hsa-miR-3925-3p	CLIP-seq
MIRT2079702	hsa-miR-4291	CLIP-seq
MIRT2079703	hsa-miR-431	CLIP-seq
MIRT1270933	hsa-miR-432	CLIP-seq
MIRT1270937	hsa-miR-4522	CLIP-seq
MIRT2079704	hsa-miR-4530	CLIP-seq
MIRT1270938	hsa-miR-4639-3p	CLIP-seq
MIRT2079705	hsa-miR-4659a-3p	CLIP-seq
MIRT1270939	hsa-miR-4659a-5p	CLIP-seq
MIRT2079706	hsa-miR-4659b-3p	CLIP-seq
MIRT1270940	hsa-miR-4659b-5p	CLIP-seq
MIRT2079707	hsa-miR-4698	CLIP-seq
MIRT2079708	hsa-miR-4711-3p	CLIP-seq
MIRT2079709	hsa-miR-4712-3p	CLIP-seq
MIRT2079710	hsa-miR-4778-5p	CLIP-seq
MIRT2079711	hsa-miR-4789-5p	CLIP-seq
MIRT2079712	hsa-miR-487a	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT2079713	hsa-miR-513c	CLIP-seq
MIRT2079714	hsa-miR-514b-5p	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT2079715	hsa-miR-555	CLIP-seq
MIRT2079716	hsa-miR-605	CLIP-seq
MIRT2079717	hsa-miR-642a	CLIP-seq
MIRT2079718	hsa-miR-760	CLIP-seq
MIRT2079719	hsa-miR-761	CLIP-seq
MIRT2079720	hsa-miR-766	CLIP-seq
MIRT2079721	hsa-miR-922	CLIP-seq
MIRT2305973	hsa-miR-1184	CLIP-seq
MIRT2305974	hsa-miR-1205	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT2305975	hsa-miR-197	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT2305976	hsa-miR-29a	CLIP-seq
MIRT2305977	hsa-miR-29b	CLIP-seq
MIRT2305978	hsa-miR-29c	CLIP-seq
MIRT2305979	hsa-miR-3065-3p	CLIP-seq
MIRT2305980	hsa-miR-3122	CLIP-seq
MIRT2305981	hsa-miR-3158-5p	CLIP-seq
MIRT2079695	hsa-miR-338-3p	CLIP-seq
MIRT2305982	hsa-miR-3675-3p	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT2305983	hsa-miR-3913-5p	CLIP-seq
MIRT2079701	hsa-miR-3925-3p	CLIP-seq
MIRT2305984	hsa-miR-412	CLIP-seq
MIRT2079702	hsa-miR-4291	CLIP-seq
MIRT2079703	hsa-miR-431	CLIP-seq
MIRT2079704	hsa-miR-4530	CLIP-seq
MIRT2305985	hsa-miR-4648	CLIP-seq
MIRT2305986	hsa-miR-4654	CLIP-seq
MIRT2079705	hsa-miR-4659a-3p	CLIP-seq
MIRT2079706	hsa-miR-4659b-3p	CLIP-seq
MIRT2305987	hsa-miR-4729	CLIP-seq
MIRT2305988	hsa-miR-4742-5p	CLIP-seq
MIRT2305989	hsa-miR-4747-5p	CLIP-seq
MIRT2305990	hsa-miR-4769-5p	CLIP-seq
MIRT2079711	hsa-miR-4789-5p	CLIP-seq
MIRT2305991	hsa-miR-508-5p	CLIP-seq
MIRT1270949	hsa-miR-519a	CLIP-seq
MIRT1270950	hsa-miR-519b-3p	CLIP-seq
MIRT1270951	hsa-miR-519c-3p	CLIP-seq
MIRT2305992	hsa-miR-544	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT2305993	hsa-miR-548ae	CLIP-seq
MIRT2305994	hsa-miR-548aj	CLIP-seq
MIRT2305995	hsa-miR-548am	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT2305996	hsa-miR-548x	CLIP-seq
MIRT2305997	hsa-miR-622	CLIP-seq
MIRT2079718	hsa-miR-760	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT2079694	hsa-miR-3182	CLIP-seq
MIRT2079703	hsa-miR-431	CLIP-seq
MIRT2079708	hsa-miR-4711-3p	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT2439624	hsa-miR-616	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT1270949	hsa-miR-519a	CLIP-seq
MIRT1270950	hsa-miR-519b-3p	CLIP-seq
MIRT1270951	hsa-miR-519c-3p	CLIP-seq
MIRT2603185	hsa-miR-1245	CLIP-seq
MIRT2603186	hsa-miR-1245b-3p	CLIP-seq
MIRT2603187	hsa-miR-1257	CLIP-seq
MIRT2603188	hsa-miR-1263	CLIP-seq
MIRT2079692	hsa-miR-1272	CLIP-seq
MIRT2603189	hsa-miR-1299	CLIP-seq
MIRT2603190	hsa-miR-1305	CLIP-seq
MIRT2603191	hsa-miR-134	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT2603192	hsa-miR-181a	CLIP-seq
MIRT2603193	hsa-miR-181b	CLIP-seq
MIRT2603194	hsa-miR-181c	CLIP-seq
MIRT2603195	hsa-miR-181d	CLIP-seq
MIRT2603196	hsa-miR-1827	CLIP-seq
MIRT2305975	hsa-miR-197	CLIP-seq
MIRT2079693	hsa-miR-214	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT2603197	hsa-miR-2682	CLIP-seq
MIRT2603198	hsa-miR-3118	CLIP-seq
MIRT2603199	hsa-miR-3157-3p	CLIP-seq
MIRT2603200	hsa-miR-3164	CLIP-seq
MIRT2079694	hsa-miR-3182	CLIP-seq
MIRT2603201	hsa-miR-3190	CLIP-seq
MIRT2603202	hsa-miR-3609	CLIP-seq
MIRT2603203	hsa-miR-3611	CLIP-seq
MIRT2603204	hsa-miR-3613-3p	CLIP-seq
MIRT2079696	hsa-miR-3619-5p	CLIP-seq
MIRT2079697	hsa-miR-3662	CLIP-seq
MIRT1270926	hsa-miR-3663-5p	CLIP-seq
MIRT2079698	hsa-miR-3667-3p	CLIP-seq
MIRT2079699	hsa-miR-3670	CLIP-seq
MIRT1270927	hsa-miR-3672	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT2603205	hsa-miR-371b-5p	CLIP-seq
MIRT2603206	hsa-miR-383	CLIP-seq
MIRT2603207	hsa-miR-3911	CLIP-seq
MIRT2079701	hsa-miR-3925-3p	CLIP-seq
MIRT2603208	hsa-miR-4262	CLIP-seq
MIRT2603209	hsa-miR-4290	CLIP-seq
MIRT2079702	hsa-miR-4291	CLIP-seq
MIRT2079703	hsa-miR-431	CLIP-seq
MIRT1270933	hsa-miR-432	CLIP-seq
MIRT2603210	hsa-miR-4328	CLIP-seq
MIRT2603211	hsa-miR-4436a	CLIP-seq
MIRT2603212	hsa-miR-4455	CLIP-seq
MIRT2603213	hsa-miR-449c	CLIP-seq
MIRT1270937	hsa-miR-4522	CLIP-seq
MIRT1270939	hsa-miR-4659a-5p	CLIP-seq
MIRT1270940	hsa-miR-4659b-5p	CLIP-seq
MIRT2079707	hsa-miR-4698	CLIP-seq
MIRT1270943	hsa-miR-4700-3p	CLIP-seq
MIRT2079708	hsa-miR-4711-3p	CLIP-seq
MIRT2079709	hsa-miR-4712-3p	CLIP-seq
MIRT1270945	hsa-miR-4742-3p	CLIP-seq
MIRT2603214	hsa-miR-4772-5p	CLIP-seq
MIRT2079710	hsa-miR-4778-5p	CLIP-seq
MIRT2603215	hsa-miR-4782-5p	CLIP-seq
MIRT2079712	hsa-miR-487a	CLIP-seq
MIRT1270947	hsa-miR-492	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT2603216	hsa-miR-516b	CLIP-seq
MIRT2603217	hsa-miR-544b	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT2603218	hsa-miR-548ah	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT2603219	hsa-miR-548t	CLIP-seq
MIRT2079715	hsa-miR-555	CLIP-seq
MIRT2439624	hsa-miR-616	CLIP-seq
MIRT2603220	hsa-miR-630	CLIP-seq
MIRT2079717	hsa-miR-642a	CLIP-seq
MIRT2603221	hsa-miR-758	CLIP-seq
MIRT2079718	hsa-miR-760	CLIP-seq
MIRT2079719	hsa-miR-761	CLIP-seq
MIRT2079720	hsa-miR-766	CLIP-seq
MIRT2603222	hsa-miR-874	CLIP-seq
MIRT2603223	hsa-miR-875-3p	CLIP-seq
MIRT2079721	hsa-miR-922	CLIP-seq
MIRT2603224	hsa-miR-944	CLIP-seq
MIRT2603186	hsa-miR-1245b-3p	CLIP-seq
MIRT2603188	hsa-miR-1263	CLIP-seq
MIRT2079692	hsa-miR-1272	CLIP-seq
MIRT2603191	hsa-miR-134	CLIP-seq
MIRT1270920	hsa-miR-140-3p	CLIP-seq
MIRT2603196	hsa-miR-1827	CLIP-seq
MIRT2079693	hsa-miR-214	CLIP-seq
MIRT1270923	hsa-miR-2467-3p	CLIP-seq
MIRT2603197	hsa-miR-2682	CLIP-seq
MIRT2603198	hsa-miR-3118	CLIP-seq
MIRT2603199	hsa-miR-3157-3p	CLIP-seq
MIRT2603200	hsa-miR-3164	CLIP-seq
MIRT2079694	hsa-miR-3182	CLIP-seq
MIRT2603201	hsa-miR-3190	CLIP-seq
MIRT2603204	hsa-miR-3613-3p	CLIP-seq
MIRT2079696	hsa-miR-3619-5p	CLIP-seq
MIRT2079697	hsa-miR-3662	CLIP-seq
MIRT2079698	hsa-miR-3667-3p	CLIP-seq
MIRT2079699	hsa-miR-3670	CLIP-seq
MIRT1270927	hsa-miR-3672	CLIP-seq
MIRT1270928	hsa-miR-3678-3p	CLIP-seq
MIRT2603205	hsa-miR-371b-5p	CLIP-seq
MIRT2603207	hsa-miR-3911	CLIP-seq
MIRT2079701	hsa-miR-3925-3p	CLIP-seq
MIRT2603209	hsa-miR-4290	CLIP-seq
MIRT2079702	hsa-miR-4291	CLIP-seq
MIRT2079703	hsa-miR-431	CLIP-seq
MIRT2603210	hsa-miR-4328	CLIP-seq
MIRT2603211	hsa-miR-4436a	CLIP-seq
MIRT2603212	hsa-miR-4455	CLIP-seq
MIRT2603213	hsa-miR-449c	CLIP-seq
MIRT2079707	hsa-miR-4698	CLIP-seq
MIRT2079708	hsa-miR-4711-3p	CLIP-seq
MIRT2079709	hsa-miR-4712-3p	CLIP-seq
MIRT1270948	hsa-miR-499a-5p	CLIP-seq
MIRT2603217	hsa-miR-544b	CLIP-seq
MIRT1270954	hsa-miR-548a-3p	CLIP-seq
MIRT1270955	hsa-miR-548e	CLIP-seq
MIRT1270956	hsa-miR-548f	CLIP-seq
MIRT2439624	hsa-miR-616	CLIP-seq
MIRT2603220	hsa-miR-630	CLIP-seq
MIRT2079717	hsa-miR-642a	CLIP-seq
MIRT2603221	hsa-miR-758	CLIP-seq
MIRT2079718	hsa-miR-760	CLIP-seq
MIRT2079719	hsa-miR-761	CLIP-seq
MIRT2079720	hsa-miR-766	CLIP-seq
MIRT2603222	hsa-miR-874	CLIP-seq
MIRT2079721	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0005515	Function	Protein binding	IPI	18845680, 25416956, 35271311
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	ISS
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IEA
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	ISS
GO:0016504	Function	Peptidase activator activity	IBA
GO:0016504	Function	Peptidase activator activity	IEA
GO:0016504	Function	Peptidase activator activity	ISS
GO:0016607	Component	Nuclear speck	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0035092	Process	Sperm DNA condensation	IEA
GO:0035092	Process	Sperm DNA condensation	ISS
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IEA
GO:0140566	Function	Histone reader activity	IBA
GO:1990111	Component	Spermatoproteasome complex	IBA
GO:1990111	Component	Spermatoproteasome complex	IEA
GO:1990111	Component	Spermatoproteasome complex	ISS

Other IDs

• MIM: 607705
• HGNC: 20635
• e!Ensembl: ENSG00000068878

Protein

• UniProt ID: Q14997
• Protein name: Proteasome activator complex subunit 4 (Proteasome activator PA200) (Protein BLM10 homolog) (Blm10) (hBlm10)
• Protein function: Associated component of the proteasome that specifically recognizes acetylated histones and promotes ATP- and ubiquitin-independent degradation of core histones during spermatogenesis and DNA damage response. Recognizes and binds acetylated hist
• PDB: 6KWX , 6KWY , 6REY , 7NAQ , 8CVS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11919	DUF3437	1756 → 1843	Domain of unknown function (DUF3437)	Family
  PF16507	BLM10_mid	330 → 828	Proteasome-substrate-size regulator, mid region	Family

• Sequence:

  MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLG
  RAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFA
  RLLINLLKKKELLSRADLELPWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSC
  RPYFPADATAEMLEEWRPLMCPFDVTMQKAITYFEIFLPTSLPPELHHKGFKLWFDELIG
  LWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPR
  FLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRL
  PNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQA
  LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTH
  MLPLLMRALPGVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSAT
  AEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKE
  IFMVALQKVFNFSTSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCCSVITQLTMN
  DDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVKILQRTLHLTCKQGYTLSCNL
  LHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWHVPSSEEVSFA
  FYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV
  PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDL
  LQFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEY
  KKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVT
  QQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLA
  EKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILLSPEKIKEGIKRQQEKNADAL
  RNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVV
  RKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK
  KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVE
  QLITFLSLEDRKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVA
  EIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKL
  HWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKN
  VRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEKLKPLMDVDEEIQNHVMEENG
  IGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVENDNSYDELKR
  DAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE
  DAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKR
  KRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEM
  TVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA

• Sequence length: 1843

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
	Cross-presentation of soluble exogenous antigens (endosomes)
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Cystitis Interstitial	Interstitial cystitis	Pubtator	39399486	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31645612		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33562813	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35344764	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22550082		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32368861	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMB11 47 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +35 more Related via 47 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMA8 47 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +35 more Related via 47 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMB9 47 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +35 more Related via 47 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMB10 47 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +35 more Related via 47 shared pathways including Proteasome, Regulation of PTEN stability and activity. PSMF1 47 shared pathwaysProteasome, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha +35 more Related via 47 shared pathways including Proteasome, Regulation of PTEN stability and activity.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMB11	0	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMA8	0	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMB9	0	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMB10	0	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]
PSMF1	0	[]	47	["Proteasome","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells","Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha"]	0	[]

Diseases Linked via Similar Genes

Proteasome associated autoinflammatory syndrome Linked via 2 of 5 related genesPSMB9, PSMB10 Periodontitis Linked via 1 of 5 related genesPSMA8 Ankylosing spondylitis Linked via 1 of 5 related genesPSMB9 Autism Linked via 1 of 5 related genesPSMB9 Autoimmune disease Linked via 1 of 5 related genesPSMB9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Proteasome associated autoinflammatory syndrome	2	["PSMB9","PSMB10"]
Periodontitis	1	["PSMA8"]
Ankylosing spondylitis	1	["PSMB9"]
Autism	1	["PSMB9"]
Autoimmune disease	1	["PSMB9"]