Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10627
Gene name	Myosin light chain 12A
Gene symbol	MYL12A
Synonyms (NCBI Gene)	HEL-S-24MLC-2BMLCBMRCL3MRLC3MYL2B
Chromosome	18
Chromosome location	18p11.31
Summary	This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcrip

204 Show/Hide all (204)

miRTarBase ID	miRNA	Experiments	Reference
MIRT462604	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT462603	hsa-miR-3154	PAR-CLIP	23592263
MIRT462602	hsa-miR-6502-3p	PAR-CLIP	23592263
MIRT462601	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT462600	hsa-miR-154-5p	PAR-CLIP	23592263
MIRT462599	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT462598	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT462597	hsa-miR-4434	PAR-CLIP	23592263
MIRT462596	hsa-miR-4516	PAR-CLIP	23592263
MIRT462595	hsa-miR-5703	PAR-CLIP	23592263
MIRT462594	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT462592	hsa-miR-4492	PAR-CLIP	23592263
MIRT462593	hsa-miR-4498	PAR-CLIP	23592263
MIRT462591	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462590	hsa-miR-762	PAR-CLIP	23592263
MIRT462589	hsa-miR-3175	PAR-CLIP	23592263
MIRT462588	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT462587	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT462586	hsa-miR-5698	PAR-CLIP	23592263
MIRT462585	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT462584	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT462583	hsa-miR-4525	PAR-CLIP	23592263
MIRT462582	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462581	hsa-miR-1275	PAR-CLIP	23592263
MIRT462580	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT462579	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462578	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT462577	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT462604	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT462603	hsa-miR-3154	PAR-CLIP	23592263
MIRT462602	hsa-miR-6502-3p	PAR-CLIP	23592263
MIRT462601	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT462600	hsa-miR-154-5p	PAR-CLIP	23592263
MIRT462599	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT462598	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT462597	hsa-miR-4434	PAR-CLIP	23592263
MIRT462596	hsa-miR-4516	PAR-CLIP	23592263
MIRT462595	hsa-miR-5703	PAR-CLIP	23592263
MIRT462594	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT462592	hsa-miR-4492	PAR-CLIP	23592263
MIRT462593	hsa-miR-4498	PAR-CLIP	23592263
MIRT462591	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT462590	hsa-miR-762	PAR-CLIP	23592263
MIRT462589	hsa-miR-3175	PAR-CLIP	23592263
MIRT462588	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT462587	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT462586	hsa-miR-5698	PAR-CLIP	23592263
MIRT462585	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT462584	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT462583	hsa-miR-4525	PAR-CLIP	23592263
MIRT462582	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462581	hsa-miR-1275	PAR-CLIP	23592263
MIRT462580	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT462579	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462578	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT462577	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1168504	hsa-miR-142-5p	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168507	hsa-miR-216a	CLIP-seq
MIRT1168508	hsa-miR-3145-3p	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168510	hsa-miR-320a	CLIP-seq
MIRT1168511	hsa-miR-320b	CLIP-seq
MIRT1168512	hsa-miR-320c	CLIP-seq
MIRT1168513	hsa-miR-320d	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT1168515	hsa-miR-3607-3p	CLIP-seq
MIRT1168516	hsa-miR-3652	CLIP-seq
MIRT1168517	hsa-miR-3662	CLIP-seq
MIRT1168518	hsa-miR-3664-5p	CLIP-seq
MIRT1168519	hsa-miR-3688-5p	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168521	hsa-miR-4251	CLIP-seq
MIRT1168522	hsa-miR-4253	CLIP-seq
MIRT1168523	hsa-miR-4330	CLIP-seq
MIRT1168524	hsa-miR-4429	CLIP-seq
MIRT1168525	hsa-miR-4430	CLIP-seq
MIRT1168526	hsa-miR-4505	CLIP-seq
MIRT1168527	hsa-miR-4522	CLIP-seq
MIRT1168528	hsa-miR-4696	CLIP-seq
MIRT1168529	hsa-miR-4698	CLIP-seq
MIRT1168530	hsa-miR-4742-3p	CLIP-seq
MIRT1168531	hsa-miR-4761-3p	CLIP-seq
MIRT1168532	hsa-miR-4796-3p	CLIP-seq
MIRT1168533	hsa-miR-520g	CLIP-seq
MIRT1168534	hsa-miR-520h	CLIP-seq
MIRT1168535	hsa-miR-548c-3p	CLIP-seq
MIRT1168536	hsa-miR-580	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168539	hsa-miR-633	CLIP-seq
MIRT1168540	hsa-miR-647	CLIP-seq
MIRT1168510	hsa-miR-320a	CLIP-seq
MIRT1168511	hsa-miR-320b	CLIP-seq
MIRT1168512	hsa-miR-320c	CLIP-seq
MIRT1168513	hsa-miR-320d	CLIP-seq
MIRT1168515	hsa-miR-3607-3p	CLIP-seq
MIRT1168524	hsa-miR-4429	CLIP-seq
MIRT1168504	hsa-miR-142-5p	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168508	hsa-miR-3145-3p	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT1168518	hsa-miR-3664-5p	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168521	hsa-miR-4251	CLIP-seq
MIRT1168527	hsa-miR-4522	CLIP-seq
MIRT1168529	hsa-miR-4698	CLIP-seq
MIRT1168530	hsa-miR-4742-3p	CLIP-seq
MIRT1168536	hsa-miR-580	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168539	hsa-miR-633	CLIP-seq
MIRT1168504	hsa-miR-142-5p	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168507	hsa-miR-216a	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168510	hsa-miR-320a	CLIP-seq
MIRT1168511	hsa-miR-320b	CLIP-seq
MIRT1168512	hsa-miR-320c	CLIP-seq
MIRT1168513	hsa-miR-320d	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT1168515	hsa-miR-3607-3p	CLIP-seq
MIRT2277388	hsa-miR-3616-5p	CLIP-seq
MIRT2277389	hsa-miR-3647-5p	CLIP-seq
MIRT1168516	hsa-miR-3652	CLIP-seq
MIRT1168518	hsa-miR-3664-5p	CLIP-seq
MIRT1168519	hsa-miR-3688-5p	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168521	hsa-miR-4251	CLIP-seq
MIRT1168522	hsa-miR-4253	CLIP-seq
MIRT1168523	hsa-miR-4330	CLIP-seq
MIRT1168524	hsa-miR-4429	CLIP-seq
MIRT1168525	hsa-miR-4430	CLIP-seq
MIRT1168526	hsa-miR-4505	CLIP-seq
MIRT1168527	hsa-miR-4522	CLIP-seq
MIRT2277390	hsa-miR-4670-3p	CLIP-seq
MIRT1168528	hsa-miR-4696	CLIP-seq
MIRT1168529	hsa-miR-4698	CLIP-seq
MIRT1168530	hsa-miR-4742-3p	CLIP-seq
MIRT1168531	hsa-miR-4761-3p	CLIP-seq
MIRT1168532	hsa-miR-4796-3p	CLIP-seq
MIRT1168533	hsa-miR-520g	CLIP-seq
MIRT1168534	hsa-miR-520h	CLIP-seq
MIRT2277391	hsa-miR-573	CLIP-seq
MIRT1168536	hsa-miR-580	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168540	hsa-miR-647	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168508	hsa-miR-3145-3p	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT2431315	hsa-miR-3647-3p	CLIP-seq
MIRT1168517	hsa-miR-3662	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT2431316	hsa-miR-4766-5p	CLIP-seq
MIRT2431317	hsa-miR-4778-5p	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168539	hsa-miR-633	CLIP-seq
MIRT1168504	hsa-miR-142-5p	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168508	hsa-miR-3145-3p	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT2431315	hsa-miR-3647-3p	CLIP-seq
MIRT1168517	hsa-miR-3662	CLIP-seq
MIRT1168518	hsa-miR-3664-5p	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168527	hsa-miR-4522	CLIP-seq
MIRT1168530	hsa-miR-4742-3p	CLIP-seq
MIRT2431316	hsa-miR-4766-5p	CLIP-seq
MIRT2431317	hsa-miR-4778-5p	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168539	hsa-miR-633	CLIP-seq
MIRT1168504	hsa-miR-142-5p	CLIP-seq
MIRT1168505	hsa-miR-145	CLIP-seq
MIRT1168506	hsa-miR-154	CLIP-seq
MIRT1168508	hsa-miR-3145-3p	CLIP-seq
MIRT1168509	hsa-miR-3180-5p	CLIP-seq
MIRT1168514	hsa-miR-340	CLIP-seq
MIRT2431315	hsa-miR-3647-3p	CLIP-seq
MIRT1168517	hsa-miR-3662	CLIP-seq
MIRT1168518	hsa-miR-3664-5p	CLIP-seq
MIRT1168520	hsa-miR-3920	CLIP-seq
MIRT1168527	hsa-miR-4522	CLIP-seq
MIRT1168530	hsa-miR-4742-3p	CLIP-seq
MIRT2431316	hsa-miR-4766-5p	CLIP-seq
MIRT2431317	hsa-miR-4778-5p	CLIP-seq
MIRT1168537	hsa-miR-622	CLIP-seq
MIRT1168538	hsa-miR-625	CLIP-seq
MIRT1168539	hsa-miR-633	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	21457715
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016459	Component	Myosin complex	IEA
GO:0016460	Component	Myosin II complex	IBA
GO:0032036	Function	Myosin heavy chain binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070527	Process	Platelet aggregation	HMP	23382103

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

P19105

Protein name

Myosin regulatory light chain 12A (Epididymis secretory protein Li 24) (HEL-S-24) (MLC-2B) (Myosin RLC) (Myosin regulatory light chain 2, nonsarcomeric) (Myosin regulatory light chain MRLC3)

Protein function

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (By similarity). {ECO:00

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08976	EF-hand_11	92 → 167	EF-hand domain	Domain
PF13405	EF-hand_6	32 → 61	EF-hand domain	Domain

Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Sequence length

171

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Axon guidance	Ephrin signaling
Focal adhesion	Smooth Muscle Contraction
Adherens junction	RHO GTPases activate PAKs
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Motor proteins
Shigellosis
Salmonella infection

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
MYL12B	[]	12	["Axon guidance","Focal adhesion","Adherens junction","Tight junction","Platelet activation","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Motor proteins","Shigellosis","Salmonella infection","Smooth Muscle Contraction","RHO GTPases activate PAKs"]	[]
MYL5	[]	9	["Axon guidance","Focal adhesion","Adherens junction","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Motor proteins","Shigellosis","Salmonella infection","Smooth Muscle Contraction"]	[]
MYL10	[]	8	["Focal adhesion","Adherens junction","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Motor proteins","Shigellosis","Salmonella infection","Smooth Muscle Contraction"]	[]
MYL9	[]	11	["Axon guidance","Focal adhesion","Adherens junction","Tight junction","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Motor proteins","Shigellosis","Salmonella infection","Smooth Muscle Contraction","RHO GTPases activate PAKs"]	[]
MYLPF	[]	8	["Focal adhesion","Adherens junction","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Motor proteins","Shigellosis","Salmonella infection","Smooth Muscle Contraction"]	[]

MYL12A (myosin light chain 12A)

Bookmark This Gene