MYL5 (myosin light chain 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4636
Gene name Myosin light chain 5
Gene symbol MYL5
Synonyms (NCBI Gene)
MYLC2
Chromosome 4
Chromosome location 4p16.3
Summary This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. Thi
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
160782 7586 ENSG00000215375
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02045
Protein name Myosin light chain 5 (Myosin regulatory light chain 5) (Superfast myosin regulatory light chain 2) (MYLC2) (MyLC-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 34 → 62 EF hand Domain
PF13202 EF-hand_5 106 → 129 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal skeletal muscle and retina.
Sequence 
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Sequence length 173
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Axon guidance Smooth Muscle Contraction
Focal adhesion  
Adherens junction  
Leukocyte transendothelial migration  
Regulation of actin cytoskeleton  
Motor proteins  
Cytoskeleton in muscle cells  
Shigellosis  
Salmonella infection  
Sort by:
MYLPF 9 shared pathwaysFocal adhesion, Adherens junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Motor proteins, Cytoskeleton in muscle cells, Shigellosis, Salmonella infection, Smooth Muscle Contraction Related via 9 shared pathways including Focal adhesion, Adherens junction. MYL7 9 shared pathwaysFocal adhesion, Adherens junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Motor proteins, Cytoskeleton in muscle cells, Shigellosis, Salmonella infection, Smooth Muscle Contraction Related via 9 shared pathways including Focal adhesion, Adherens junction. MYL10 8 shared pathwaysFocal adhesion, Adherens junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Motor proteins, Shigellosis, Salmonella infection, Smooth Muscle Contraction Related via 8 shared pathways including Focal adhesion, Adherens junction. MYL12B 9 shared pathwaysAxon guidance, Focal adhesion, Adherens junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Motor proteins, Shigellosis, Salmonella infection, Smooth Muscle Contraction Related via 9 shared pathways including Axon guidance, Focal adhesion. MYL12A 9 shared pathwaysAxon guidance, Focal adhesion, Adherens junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Motor proteins, Shigellosis, Salmonella infection, Smooth Muscle Contraction Related via 9 shared pathways including Axon guidance, Focal adhesion.
Cardiomyopathy Linked via 1 of 5 related genesMYL7 Carpal tunnel syndrome Linked via 1 of 5 related genesMYL7 Hypertrophic cardiomyopathy Linked via 1 of 5 related genesMYL7 Diabetes mellitus type 2 Linked via 1 of 5 related genesMYL7 Alzheimer disease Linked via 1 of 5 related genesMYL10