Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	999
Gene name Gene Name - the full gene name approved by the HGNC.	Cadherin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDH1
Synonyms (NCBI Gene) Gene synonyms aliases	Arc-1, BCDS1, CD324, CDHE, ECAD, LCAM, UVO
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This cal

Show/Hide all(231)

SNP ID	Visualize variation	Clinical significance	Consequence
rs16260	C>A	Risk-factor	Upstream transcript variant
rs33935154	G>A,T	Benign, pathogenic, benign-likely-benign, uncertain-significance	5 prime UTR variant, missense variant, coding sequence variant
rs34507583	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs35572355	G>A,C,T	Conflicting-interpretations-of-pathogenicity, benign, likely-benign, uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs35606263	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, missense variant, coding sequence variant
rs36087757	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, missense variant, coding sequence variant
rs61747631	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, missense variant, coding sequence variant
rs111662525	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	5 prime UTR variant, coding sequence variant, missense variant
rs113055163	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant
rs113583899	G>C	Likely-pathogenic	Intron variant, splice acceptor variant
rs116093741	A>G,T	Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign	5 prime UTR variant, coding sequence variant, missense variant
rs121964871	C>G	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs121964872	A>G	Conflicting-interpretations-of-pathogenicity, likely-benign, pathogenic	Coding sequence variant, missense variant
rs121964873	G>A,T	Likely-pathogenic, uncertain-significance, pathogenic	5 prime UTR variant, coding sequence variant, stop gained, missense variant
rs121964874	C>A,G,T	Uncertain-significance, pathogenic	Coding sequence variant, stop gained, missense variant
rs121964875	G>A,C	Uncertain-significance, pathogenic	5 prime UTR variant, missense variant, coding sequence variant, stop gained
rs121964876	G>A,T	Uncertain-significance, pathogenic	5 prime UTR variant, coding sequence variant, stop gained, missense variant
rs121964877	C>G,T	Uncertain-significance, pathogenic	5 prime UTR variant, coding sequence variant, stop gained, missense variant
rs121964878	C>T	Likely-pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs142498771	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Coding sequence variant, 5 prime UTR variant, missense variant
rs142822590	G>A	Conflicting-interpretations-of-pathogenicity, benign, uncertain-significance, likely-benign, benign-likely-benign	Coding sequence variant, 5 prime UTR variant, missense variant
rs149127230	G>A,C,T	Uncertain-significance, benign, likely-pathogenic, likely-benign, benign-likely-benign	Coding sequence variant, stop gained, missense variant
rs187862045	C>G,T	Likely-pathogenic, likely-benign, uncertain-significance	Synonymous variant, missense variant, 5 prime UTR variant, coding sequence variant, intron variant
rs200894246	G>A	Benign-likely-benign, likely-benign, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200911775	G>A,C	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs201141645	A>C,G	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, synonymous variant, 5 prime UTR variant
rs201223411	G>A	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	3 prime UTR variant
rs201511530	G>A,T	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, 5 prime UTR variant
rs201637081	A>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs267606712	G>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, synonymous variant, 5 prime UTR variant
rs372838203	G>A	Likely-benign, not-provided, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, intron variant, 5 prime UTR variant
rs372989292	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs570930882	G>A,C	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, missense variant, 5 prime UTR variant
rs587776398	T>C,G	Likely-benign, pathogenic	Stop gained, synonymous variant, 5 prime UTR variant, coding sequence variant
rs587776399	T>G	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Missense variant, 5 prime UTR variant, coding sequence variant
rs587778174	T>C,G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, coding sequence variant
rs587780112	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, 5 prime UTR variant, coding sequence variant
rs587780113	G>A,C,T	Pathogenic	Splice donor variant
rs587780114	C>G	Conflicting-interpretations-of-pathogenicity	Intron variant
rs587780117	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign, benign	Missense variant, 5 prime UTR variant, coding sequence variant
rs587780118	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs587780119	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Missense variant, synonymous variant, coding sequence variant
rs587780537	G>A	Pathogenic-likely-pathogenic, conflicting-interpretations-of-pathogenicity, likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs587780784	C>G,T	Uncertain-significance, pathogenic	Missense variant, stop gained, 5 prime UTR variant, coding sequence variant
rs587780787	G>A,T	Pathogenic-likely-pathogenic, uncertain-significance, pathogenic	Missense variant, stop gained, coding sequence variant
rs587781276	TG>-	Pathogenic	Inframe indel, stop gained, coding sequence variant
rs587781290	->A	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs587781919	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Splice donor variant
rs587782381	C>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, intron variant, coding sequence variant
rs587782549	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs587782647	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, 5 prime UTR variant, coding sequence variant
rs587782750	C>T	Likely-pathogenic, pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs587782757	CTT>-	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs587782798	C>T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant, intron variant
rs587782810	GTAA>-	Uncertain-significance, likely-pathogenic	Splice donor variant, intron variant, coding sequence variant
rs587783047	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs587783048	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs587783050	G>A,T	Likely-pathogenic, pathogenic	Synonymous variant, 5 prime UTR variant, coding sequence variant
rs730881653	->T	Pathogenic	Frameshift variant, coding sequence variant
rs730881663	C>A	Likely-pathogenic, pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs746481984	C>G,T	Uncertain-significance, likely-pathogenic, pathogenic	Missense variant, intron variant, coding sequence variant
rs747783435	C>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs748086082	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, 5 prime UTR variant, coding sequence variant
rs750651204	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant
rs754143182	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, 5 prime UTR variant, coding sequence variant
rs759380419	A>C,G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs771085839	G>C	Likely-pathogenic	Splice acceptor variant
rs774761552	C>A,T	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs776805501	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, 5 prime UTR variant, intron variant, synonymous variant
rs776890776	A>C,G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, intron variant, missense variant
rs778871891	G>C,T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant, missense variant
rs781317341	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, 5 prime UTR variant, synonymous variant
rs781409616	C>T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs781513008	G>A	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, 5 prime UTR variant, missense variant
rs781633588	T>C	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs786201045	AG>-	Pathogenic	Coding sequence variant, splice acceptor variant, 5 prime UTR variant
rs786201058	G>A,C,T	Uncertain-significance, likely-pathogenic, pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant, missense variant
rs786201463	C>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, 5 prime UTR variant, synonymous variant
rs786201861	G>A	Uncertain-significance, likely-pathogenic	Intron variant
rs786202033	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs786202151	T>-	Pathogenic, likely-pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant
rs786202290	G>A	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs786202712	C>G,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs786202785	G>A,T	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs786202817	T>C	Likely-pathogenic	Splice donor variant
rs786203089	TAAGGG>-	Pathogenic, likely-pathogenic	Splice donor variant, intron variant, coding sequence variant
rs786203576	G>A	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs786203752	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs864622655	A>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant
rs869312765	G>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs876658261	CGAGGAC>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs876658575	C>T	Pathogenic	Stop gained, coding sequence variant
rs876658865	CCC>T	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs876658932	C>G,T	Pathogenic, uncertain-significance	Missense variant, stop gained, 5 prime UTR variant, coding sequence variant
rs876658944	T>A,C	Pathogenic, likely-benign	Synonymous variant, stop gained, coding sequence variant
rs876659208	AG>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs876659446	G>-	Pathogenic	Splice donor variant, 5 prime UTR variant, coding sequence variant
rs876659503	G>A,C,T	Pathogenic, uncertain-significance	Missense variant, stop gained, 5 prime UTR variant, coding sequence variant
rs876659716	T>A,C	Pathogenic, likely-benign	Stop gained, synonymous variant, intron variant, coding sequence variant
rs876660393	A>G	Likely-pathogenic	Splice acceptor variant
rs876660771	G>A	Pathogenic, likely-pathogenic, pathogenic-likely-pathogenic	Splice donor variant
rs876661091	G>A	Likely-pathogenic, uncertain-significance	Missense variant, 5 prime UTR variant, coding sequence variant
rs876661106	A>G,T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, stop gained, 5 prime UTR variant, coding sequence variant
rs876661107	G>A	Likely-pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs876661118	->C	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs876661120	T>C	Pathogenic	Splice donor variant
rs878854690	G>-,GG	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs878854691	G>A	Pathogenic	Missense variant, initiator codon variant, 5 prime UTR variant
rs878854697	G>A,T	Pathogenic, likely-pathogenic	Splice donor variant
rs886037822	C>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant, intron variant
rs886039590	G>A,C	Likely-pathogenic, uncertain-significance	Missense variant, stop gained, intron variant, coding sequence variant
rs886039612	CTAC>-	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs886039685	G>C	Pathogenic	Splice donor variant, 5 prime UTR variant, intron variant
rs886041161	G>A,C	Pathogenic, likely-pathogenic	Splice donor variant, intron variant
rs971882211	G>C,T	Uncertain-significance, pathogenic-likely-pathogenic	5 prime UTR variant, coding sequence variant, stop gained, missense variant
rs1057517542	G>A	Likely-pathogenic, pathogenic-likely-pathogenic	Splice acceptor variant
rs1057522088	T>C	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs1060501214	TC>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1060501215	C>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1060501224	AC>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1060501226	A>G	Pathogenic	Splice acceptor variant
rs1060501229	A>G	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, coding sequence variant, synonymous variant
rs1060501237	T>C	Likely-pathogenic	Splice donor variant
rs1060501244	G>A,T	Likely-pathogenic, pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs1060501248	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1064794230	C>A,G	Uncertain-significance, pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant, missense variant
rs1064795267	G>-	Pathogenic	Splice donor variant
rs1064795703	C>-	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690808	G>A,T	Likely-pathogenic, pathogenic	Splice donor variant
rs1131690809	T>-	Likely-pathogenic, pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690810	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1131690811	->TA	Pathogenic	Frameshift variant, 5 prime UTR variant, intron variant, coding sequence variant
rs1131690812	C>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690813	C>T	Pathogenic	Stop gained, coding sequence variant
rs1131690815	CAGAAGA>-,CAGAAGACAGAAGA	Likely-pathogenic, pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690817	->G	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690818	G>A	Pathogenic	Intron variant
rs1131690819	T>-	Likely-pathogenic, pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690820	A>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1131690821	A>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1131690822	->G	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1375617541	C>-,CC	Likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant
rs1385720097	G>C,T	Likely-pathogenic	Splice acceptor variant
rs1440280370	G>A,T	Pathogenic	Splice donor variant
rs1555509622	A>G	Pathogenic	Missense variant, initiator codon variant, 5 prime UTR variant
rs1555509623	T>C,G	Pathogenic	Missense variant, initiator codon variant, 5 prime UTR variant
rs1555509636	G>A	Likely-pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555509646	C>A,T	Pathogenic, uncertain-significance	Stop gained, missense variant, 5 prime UTR variant, coding sequence variant
rs1555514406	->T	Pathogenic, likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555514429	G>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555514464	G>A	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555514492	C>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515197	TC>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515210	AGAAGAGAGAC>-	Pathogenic, likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515214	AAGA>-	Pathogenic, likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515215	G>A	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555515217	CATCAGC>AGAATA	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515232	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555515264	->T	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515284	C>-	Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515296	GT>-	Pathogenic	Splice donor variant, 5 prime UTR variant, coding sequence variant
rs1555515297	T>C	Likely-pathogenic	Splice donor variant
rs1555515445	G>C,T	Pathogenic, uncertain-significance	Missense variant, 5 prime UTR variant, coding sequence variant
rs1555515596	A>G	Pathogenic	Splice acceptor variant
rs1555515721	->TG	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515726	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555515731	T>-	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1555515739	T>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555515863	G>-	Likely-pathogenic	Frameshift variant, intron variant, 5 prime UTR variant, coding sequence variant
rs1555515920	A>-	Likely-pathogenic	Frameshift variant, intron variant, 5 prime UTR variant, coding sequence variant
rs1555515925	G>T	Pathogenic	Missense variant, intron variant, 5 prime UTR variant, coding sequence variant
rs1555516089	G>-	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555516111	G>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555516137	T>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555516191	AACAGAAAATAACGTAAGTGTGAGGATTTTTCAACTGACTTGCAGCAACTGG>-	Likely-pathogenic	Initiator codon variant, coding sequence variant, splice donor variant, intron variant, 5 prime UTR variant
rs1555516200	->T,TT	Pathogenic, pathogenic-likely-pathogenic	Splice donor variant
rs1555516520	A>G	Likely-pathogenic	Intron variant, splice acceptor variant
rs1555516532	->T	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1555516535	->C	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1555516545	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1555516556	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1555516567	->C	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1555516821	->C	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555516896	CA>-	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555517074	AT>-,ATAT	Pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant
rs1555517099	C>A	Pathogenic	Missense variant, coding sequence variant
rs1555517100	->C	Pathogenic, likely-pathogenic	Frameshift variant, coding sequence variant
rs1555517136	T>-	Pathogenic, likely-pathogenic	Frameshift variant, coding sequence variant
rs1555517153	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555517680	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555517889	GGTATCTTCCCCGCCCTGCC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555518210	A>G	Pathogenic, likely-pathogenic	Splice acceptor variant
rs1555518211	A>G,T	Likely-pathogenic, uncertain-significance	Missense variant, stop gained, coding sequence variant
rs1555518221	C>-,CC	Pathogenic, likely-pathogenic	Frameshift variant, coding sequence variant
rs1555518239	G>T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs1567471351	CTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGT>-	Pathogenic	Splice donor variant, coding sequence variant, 5 prime UTR variant, splice acceptor variant
rs1567501500	->CCGCCCC	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567504575	A>T	Pathogenic	Stop gained, coding sequence variant, 5 prime UTR variant
rs1567504977	G>A	Likely-pathogenic, pathogenic	Splice donor variant
rs1567506511	TCTTCCAGGAAC>-	Likely-pathogenic	Intron variant, coding sequence variant, 5 prime UTR variant, splice acceptor variant
rs1567507138	C>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567507724	C>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567507825	->GT	Pathogenic	Intron variant, coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567508847	A>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567508939	TG>-	Likely-pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1567512585	G>A	Pathogenic	Stop gained, coding sequence variant, 5 prime UTR variant
rs1567512631	G>A	Likely-pathogenic, uncertain-significance	Intron variant
rs1567513227	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1567516230	G>T	Likely-pathogenic	Splice donor variant
rs1596960368	G>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs1596960393	T>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant
rs1596963500	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, 5 prime UTR variant
rs1596963827	->A	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1596965628	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1596970624	A>G	Likely-pathogenic	Splice acceptor variant
rs1596970676	TGTTTCTTCGG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1596970988	C>A	Pathogenic	Coding sequence variant, stop gained
rs1596971108	G>C	Likely-pathogenic	Splice donor variant
rs1596976114	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1596976243	->A	Likely-pathogenic	Coding sequence variant, stop gained
rs1597884512	G>A	Likely-pathogenic	Splice acceptor variant
rs1597884637	->A	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597890755	T>A	Pathogenic	Splice donor variant
rs1597890963	->A	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597891145	A>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597893910	G>A	Pathogenic	Splice acceptor variant
rs1597894239	->A	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597894632	G>C	Likely-pathogenic	Splice acceptor variant
rs1597895871	C>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597897893	TC>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1597897917	TCACCACCTCCAC>AAA	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant

Show/Hide all(1076)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000029	hsa-miR-9-5p	Western blot	19572217
MIRT006029	hsa-miR-92a-3p	Luciferase reporter assay, Northern blot, qRT-PCR	21148309
MIRT006230	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	22450326
MIRT006029	hsa-miR-92a-3p	Luciferase reporter assay, Northern blot, qRT-PCR	21148309
MIRT006230	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	22450326
MIRT006029	hsa-miR-92a-3p	Luciferase reporter assay, Northern blot, qRT-PCR	21148309
MIRT006230	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	22450326
MIRT016469	hsa-miR-193b-3p	Proteomics	21512034
MIRT000029	hsa-miR-9-5p	Reporter assay;Western blot	20173740
MIRT021686	hsa-miR-138-5p	Western blot	21770894
MIRT029643	hsa-miR-26b-5p	Microarray	19088304
MIRT047874	hsa-miR-30c-5p	CLASH	23622248
MIRT053083	hsa-miR-23a-3p	qRT-PCR, Western blot	22752005
MIRT053083	hsa-miR-23a-3p	qRT-PCR, Western blot	22752005
MIRT053131	hsa-miR-30a-5p	In situ hybridization, qRT-PCR, Western blot	24812123
MIRT054132	hsa-miR-199a-5p	Immunofluorescence, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25080937
MIRT054132	hsa-miR-199a-5p	Immunofluorescence, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25080937
MIRT054802	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	24940073
MIRT054864	hsa-miR-204-5p	5.0	24280681
MIRT438619	hsa-miR-224-5p	qRT-PCR	22989374
MIRT438185	hsa-miR-888-5p	Luciferase reporter assay, qRT-PCR, Western blot	24480745
MIRT438034	hsa-miR-371a-5p	qRT-PCR	24367666
MIRT438027	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438027	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438026	hsa-miR-1323	qRT-PCR	24367666
MIRT438619	hsa-miR-224-5p	qRT-PCR	22989374
MIRT438185	hsa-miR-888-5p	Luciferase reporter assay, qRT-PCR, Western blot	24480745
MIRT438034	hsa-miR-371a-5p	qRT-PCR	24367666
MIRT438027	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438027	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438026	hsa-miR-1323	qRT-PCR	24367666
MIRT731384	hsa-miR-421	Luciferase reporter assay	27016414
MIRT731384	hsa-miR-421	Luciferase reporter assay	27016414
MIRT438619	hsa-miR-224-5p	Luciferase reporter assay, Western blot	25804630
MIRT054802	hsa-miR-544a	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26264654
MIRT054802	hsa-miR-544a	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26264654
MIRT054802	hsa-miR-544a	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26264654
MIRT054802	hsa-miR-544a	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26264654
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27447934
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27447934
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27447934
MIRT731384	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT731384	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR	26206264
MIRT054132	hsa-miR-199a-5p	qRT-PCR, Western blot	27347107
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	28107581
MIRT438027	hsa-miR-34c-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	32586280
MIRT734154	hsa-miR-93-5p	Flow cytometry, qRT-PCR	33826035
MIRT734155	hsa-miR-17-5p	Flow cytometry, qRT-PCR	33826035
MIRT000029	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	33758511
MIRT736657	hsa-miR-296-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31672157
MIRT879355	hsa-let-7a	CLIP-seq
MIRT879356	hsa-let-7b	CLIP-seq
MIRT879357	hsa-let-7c	CLIP-seq
MIRT879358	hsa-let-7d	CLIP-seq
MIRT879359	hsa-let-7e	CLIP-seq
MIRT879360	hsa-let-7f	CLIP-seq
MIRT879361	hsa-let-7g	CLIP-seq
MIRT879362	hsa-let-7i	CLIP-seq
MIRT879363	hsa-miR-103a	CLIP-seq
MIRT879364	hsa-miR-107	CLIP-seq
MIRT879365	hsa-miR-10a	CLIP-seq
MIRT879366	hsa-miR-10b	CLIP-seq
MIRT879367	hsa-miR-1184	CLIP-seq
MIRT879368	hsa-miR-1202	CLIP-seq
MIRT879369	hsa-miR-1207-5p	CLIP-seq
MIRT879370	hsa-miR-1224-3p	CLIP-seq
MIRT879371	hsa-miR-1225-3p	CLIP-seq
MIRT879372	hsa-miR-1225-5p	CLIP-seq
MIRT879373	hsa-miR-1226	CLIP-seq
MIRT879374	hsa-miR-1228	CLIP-seq
MIRT879375	hsa-miR-1233	CLIP-seq
MIRT879376	hsa-miR-1237	CLIP-seq
MIRT879377	hsa-miR-1243	CLIP-seq
MIRT879378	hsa-miR-1248	CLIP-seq
MIRT879379	hsa-miR-1262	CLIP-seq
MIRT879380	hsa-miR-1264	CLIP-seq
MIRT879381	hsa-miR-1273e	CLIP-seq
MIRT879382	hsa-miR-1275	CLIP-seq
MIRT879383	hsa-miR-1276	CLIP-seq
MIRT879384	hsa-miR-1285	CLIP-seq
MIRT879385	hsa-miR-1296	CLIP-seq
MIRT879386	hsa-miR-1299	CLIP-seq
MIRT879387	hsa-miR-1304	CLIP-seq
MIRT879388	hsa-miR-1305	CLIP-seq
MIRT879389	hsa-miR-136	CLIP-seq
MIRT879390	hsa-miR-139-5p	CLIP-seq
MIRT879391	hsa-miR-143	CLIP-seq
MIRT879392	hsa-miR-18a	CLIP-seq
MIRT879393	hsa-miR-18b	CLIP-seq
MIRT879394	hsa-miR-1909	CLIP-seq
MIRT879395	hsa-miR-1911	CLIP-seq
MIRT879396	hsa-miR-193a-5p	CLIP-seq
MIRT879397	hsa-miR-197	CLIP-seq
MIRT879398	hsa-miR-1976	CLIP-seq
MIRT879399	hsa-miR-199b-5p	CLIP-seq
MIRT879400	hsa-miR-202	CLIP-seq
MIRT879401	hsa-miR-203	CLIP-seq
MIRT879402	hsa-miR-208a	CLIP-seq
MIRT879403	hsa-miR-208b	CLIP-seq
MIRT879404	hsa-miR-2110	CLIP-seq
MIRT879405	hsa-miR-2116	CLIP-seq
MIRT879406	hsa-miR-217	CLIP-seq
MIRT879407	hsa-miR-219-1-3p	CLIP-seq
MIRT879408	hsa-miR-219-2-3p	CLIP-seq
MIRT879409	hsa-miR-219-5p	CLIP-seq
MIRT879410	hsa-miR-22	CLIP-seq
MIRT879411	hsa-miR-224	CLIP-seq
MIRT879412	hsa-miR-2276	CLIP-seq
MIRT879413	hsa-miR-23a	CLIP-seq
MIRT879414	hsa-miR-23b	CLIP-seq
MIRT879415	hsa-miR-23c	CLIP-seq
MIRT879416	hsa-miR-24	CLIP-seq
MIRT879417	hsa-miR-2467-3p	CLIP-seq
MIRT879418	hsa-miR-25	CLIP-seq
MIRT879419	hsa-miR-2909	CLIP-seq
MIRT879420	hsa-miR-2964a-3p	CLIP-seq
MIRT879421	hsa-miR-298	CLIP-seq
MIRT879422	hsa-miR-3065-3p	CLIP-seq
MIRT879423	hsa-miR-3065-5p	CLIP-seq
MIRT879424	hsa-miR-3074-3p	CLIP-seq
MIRT879425	hsa-miR-3120-5p	CLIP-seq
MIRT879426	hsa-miR-3126-5p	CLIP-seq
MIRT879427	hsa-miR-3127-3p	CLIP-seq
MIRT879428	hsa-miR-3137	CLIP-seq
MIRT879429	hsa-miR-3145-3p	CLIP-seq
MIRT879430	hsa-miR-3150a-3p	CLIP-seq
MIRT879431	hsa-miR-3155	CLIP-seq
MIRT879432	hsa-miR-3155b	CLIP-seq
MIRT879433	hsa-miR-3157-5p	CLIP-seq
MIRT879434	hsa-miR-3160-3p	CLIP-seq
MIRT879435	hsa-miR-3175	CLIP-seq
MIRT879436	hsa-miR-3180-5p	CLIP-seq
MIRT879437	hsa-miR-3182	CLIP-seq
MIRT879438	hsa-miR-3183	CLIP-seq
MIRT879439	hsa-miR-3187-5p	CLIP-seq
MIRT879440	hsa-miR-3192	CLIP-seq
MIRT879441	hsa-miR-32	CLIP-seq
MIRT879442	hsa-miR-320a	CLIP-seq
MIRT879443	hsa-miR-320b	CLIP-seq
MIRT879444	hsa-miR-320c	CLIP-seq
MIRT879445	hsa-miR-320d	CLIP-seq
MIRT879446	hsa-miR-323b-3p	CLIP-seq
MIRT879447	hsa-miR-326	CLIP-seq
MIRT879448	hsa-miR-329	CLIP-seq
MIRT879449	hsa-miR-330-5p	CLIP-seq
MIRT879450	hsa-miR-338-3p	CLIP-seq
MIRT879451	hsa-miR-339-5p	CLIP-seq
MIRT879452	hsa-miR-3529	CLIP-seq
MIRT879453	hsa-miR-3545-3p	CLIP-seq
MIRT879454	hsa-miR-3607-3p	CLIP-seq
MIRT879455	hsa-miR-3609	CLIP-seq
MIRT879456	hsa-miR-3612	CLIP-seq
MIRT879457	hsa-miR-3613-3p	CLIP-seq
MIRT879458	hsa-miR-3614-5p	CLIP-seq
MIRT879459	hsa-miR-3615	CLIP-seq
MIRT879460	hsa-miR-361-5p	CLIP-seq
MIRT879461	hsa-miR-3622a-5p	CLIP-seq
MIRT879462	hsa-miR-362-3p	CLIP-seq
MIRT879463	hsa-miR-363	CLIP-seq
MIRT879464	hsa-miR-3653	CLIP-seq
MIRT879465	hsa-miR-3658	CLIP-seq
MIRT879466	hsa-miR-3664-3p	CLIP-seq
MIRT879467	hsa-miR-3664-5p	CLIP-seq
MIRT879468	hsa-miR-3665	CLIP-seq
MIRT879469	hsa-miR-3667-3p	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879471	hsa-miR-367	CLIP-seq
MIRT879472	hsa-miR-3672	CLIP-seq
MIRT879473	hsa-miR-3686	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879476	hsa-miR-3690	CLIP-seq
MIRT879477	hsa-miR-3692	CLIP-seq
MIRT879478	hsa-miR-3714	CLIP-seq
MIRT879479	hsa-miR-371b-5p	CLIP-seq
MIRT879480	hsa-miR-376a	CLIP-seq
MIRT879481	hsa-miR-376b	CLIP-seq
MIRT879482	hsa-miR-378g	CLIP-seq
MIRT879483	hsa-miR-379	CLIP-seq
MIRT879484	hsa-miR-382	CLIP-seq
MIRT879485	hsa-miR-3913-3p	CLIP-seq
MIRT879486	hsa-miR-3919	CLIP-seq
MIRT879487	hsa-miR-3927	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879489	hsa-miR-3942-3p	CLIP-seq
MIRT879490	hsa-miR-3972	CLIP-seq
MIRT879491	hsa-miR-411	CLIP-seq
MIRT879492	hsa-miR-4254	CLIP-seq
MIRT879493	hsa-miR-4259	CLIP-seq
MIRT879494	hsa-miR-4260	CLIP-seq
MIRT879495	hsa-miR-4263	CLIP-seq
MIRT879496	hsa-miR-4268	CLIP-seq
MIRT879497	hsa-miR-4269	CLIP-seq
MIRT879498	hsa-miR-4270	CLIP-seq
MIRT879499	hsa-miR-4273	CLIP-seq
MIRT879500	hsa-miR-4280	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879502	hsa-miR-4282	CLIP-seq
MIRT879503	hsa-miR-4284	CLIP-seq
MIRT879504	hsa-miR-4300	CLIP-seq
MIRT879505	hsa-miR-4310	CLIP-seq
MIRT879506	hsa-miR-4311	CLIP-seq
MIRT879507	hsa-miR-4314	CLIP-seq
MIRT879508	hsa-miR-4320	CLIP-seq
MIRT879509	hsa-miR-4328	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879511	hsa-miR-4421	CLIP-seq
MIRT879512	hsa-miR-4423-3p	CLIP-seq
MIRT879513	hsa-miR-4426	CLIP-seq
MIRT879514	hsa-miR-4429	CLIP-seq
MIRT879515	hsa-miR-4433	CLIP-seq
MIRT879516	hsa-miR-4435	CLIP-seq
MIRT879517	hsa-miR-4441	CLIP-seq
MIRT879518	hsa-miR-4443	CLIP-seq
MIRT879519	hsa-miR-4445	CLIP-seq
MIRT879520	hsa-miR-4448	CLIP-seq
MIRT879521	hsa-miR-4450	CLIP-seq
MIRT879522	hsa-miR-4452	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT879524	hsa-miR-4458	CLIP-seq
MIRT879525	hsa-miR-4459	CLIP-seq
MIRT879526	hsa-miR-4468	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879528	hsa-miR-4486	CLIP-seq
MIRT879529	hsa-miR-4487	CLIP-seq
MIRT879530	hsa-miR-4495	CLIP-seq
MIRT879531	hsa-miR-4500	CLIP-seq
MIRT879532	hsa-miR-4502	CLIP-seq
MIRT879533	hsa-miR-4505	CLIP-seq
MIRT879534	hsa-miR-4512	CLIP-seq
MIRT879535	hsa-miR-451b	CLIP-seq
MIRT879536	hsa-miR-4520a-3p	CLIP-seq
MIRT879537	hsa-miR-4520b-3p	CLIP-seq
MIRT879538	hsa-miR-4529-3p	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879540	hsa-miR-4637	CLIP-seq
MIRT879541	hsa-miR-4639-3p	CLIP-seq
MIRT879542	hsa-miR-4639-5p	CLIP-seq
MIRT879543	hsa-miR-4640-3p	CLIP-seq
MIRT879544	hsa-miR-4641	CLIP-seq
MIRT879545	hsa-miR-4643	CLIP-seq
MIRT879546	hsa-miR-4646-5p	CLIP-seq
MIRT879547	hsa-miR-4647	CLIP-seq
MIRT879548	hsa-miR-4652-3p	CLIP-seq
MIRT879549	hsa-miR-4659a-3p	CLIP-seq
MIRT879550	hsa-miR-4659b-3p	CLIP-seq
MIRT879551	hsa-miR-4660	CLIP-seq
MIRT879552	hsa-miR-4662b	CLIP-seq
MIRT879553	hsa-miR-4665-5p	CLIP-seq
MIRT879554	hsa-miR-4667-5p	CLIP-seq
MIRT879555	hsa-miR-4672	CLIP-seq
MIRT879556	hsa-miR-4677-5p	CLIP-seq
MIRT879557	hsa-miR-4679	CLIP-seq
MIRT879558	hsa-miR-4684-5p	CLIP-seq
MIRT879559	hsa-miR-4690-5p	CLIP-seq
MIRT879560	hsa-miR-4691-3p	CLIP-seq
MIRT879561	hsa-miR-4691-5p	CLIP-seq
MIRT879562	hsa-miR-4693-3p	CLIP-seq
MIRT879563	hsa-miR-4696	CLIP-seq
MIRT879564	hsa-miR-4700-5p	CLIP-seq
MIRT879565	hsa-miR-4701-3p	CLIP-seq
MIRT879566	hsa-miR-4707-3p	CLIP-seq
MIRT879567	hsa-miR-4708-3p	CLIP-seq
MIRT879568	hsa-miR-4711-5p	CLIP-seq
MIRT879569	hsa-miR-4713-5p	CLIP-seq
MIRT879570	hsa-miR-4714-5p	CLIP-seq
MIRT879571	hsa-miR-4717-3p	CLIP-seq
MIRT879572	hsa-miR-4719	CLIP-seq
MIRT879573	hsa-miR-4722-3p	CLIP-seq
MIRT879574	hsa-miR-4723-3p	CLIP-seq
MIRT879575	hsa-miR-4725-5p	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879577	hsa-miR-4731-3p	CLIP-seq
MIRT879578	hsa-miR-4731-5p	CLIP-seq
MIRT879579	hsa-miR-4733-5p	CLIP-seq
MIRT879580	hsa-miR-4735-3p	CLIP-seq
MIRT879581	hsa-miR-4736	CLIP-seq
MIRT879582	hsa-miR-4738-3p	CLIP-seq
MIRT879583	hsa-miR-4753-3p	CLIP-seq
MIRT879584	hsa-miR-4755-3p	CLIP-seq
MIRT879585	hsa-miR-4756-3p	CLIP-seq
MIRT879586	hsa-miR-4761-5p	CLIP-seq
MIRT879587	hsa-miR-4762-3p	CLIP-seq
MIRT879588	hsa-miR-4763-3p	CLIP-seq
MIRT879589	hsa-miR-4765	CLIP-seq
MIRT879590	hsa-miR-4768-3p	CLIP-seq
MIRT879591	hsa-miR-4769-3p	CLIP-seq
MIRT879592	hsa-miR-4770	CLIP-seq
MIRT879593	hsa-miR-4772-3p	CLIP-seq
MIRT879594	hsa-miR-4778-3p	CLIP-seq
MIRT879595	hsa-miR-4782-3p	CLIP-seq
MIRT879596	hsa-miR-4782-5p	CLIP-seq
MIRT879597	hsa-miR-4786-5p	CLIP-seq
MIRT879598	hsa-miR-4789-5p	CLIP-seq
MIRT879599	hsa-miR-4793-3p	CLIP-seq
MIRT879600	hsa-miR-4793-5p	CLIP-seq
MIRT879601	hsa-miR-4801	CLIP-seq
MIRT879602	hsa-miR-4802-3p	CLIP-seq
MIRT879603	hsa-miR-4802-5p	CLIP-seq
MIRT879604	hsa-miR-484	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879606	hsa-miR-499-3p	CLIP-seq
MIRT879607	hsa-miR-499-5p	CLIP-seq
MIRT879608	hsa-miR-499a-3p	CLIP-seq
MIRT879609	hsa-miR-504	CLIP-seq
MIRT879610	hsa-miR-508-3p	CLIP-seq
MIRT879611	hsa-miR-508-5p	CLIP-seq
MIRT879612	hsa-miR-510	CLIP-seq
MIRT879613	hsa-miR-511	CLIP-seq
MIRT879614	hsa-miR-512-5p	CLIP-seq
MIRT879615	hsa-miR-515-5p	CLIP-seq
MIRT879616	hsa-miR-516a-5p	CLIP-seq
MIRT879617	hsa-miR-516b	CLIP-seq
MIRT879618	hsa-miR-520a-5p	CLIP-seq
MIRT879619	hsa-miR-525-5p	CLIP-seq
MIRT879620	hsa-miR-539	CLIP-seq
MIRT879621	hsa-miR-544	CLIP-seq
MIRT879622	hsa-miR-548aa	CLIP-seq
MIRT879623	hsa-miR-548ac	CLIP-seq
MIRT879624	hsa-miR-548ah	CLIP-seq
MIRT879625	hsa-miR-548an	CLIP-seq
MIRT879626	hsa-miR-548c-3p	CLIP-seq
MIRT879627	hsa-miR-548d-3p	CLIP-seq
MIRT879628	hsa-miR-548g	CLIP-seq
MIRT879629	hsa-miR-548m	CLIP-seq
MIRT879630	hsa-miR-548n	CLIP-seq
MIRT879631	hsa-miR-548o	CLIP-seq
MIRT879632	hsa-miR-548t	CLIP-seq
MIRT879633	hsa-miR-548z	CLIP-seq
MIRT879634	hsa-miR-550b	CLIP-seq
MIRT879635	hsa-miR-555	CLIP-seq
MIRT879636	hsa-miR-558	CLIP-seq
MIRT879637	hsa-miR-561	CLIP-seq
MIRT879638	hsa-miR-571	CLIP-seq
MIRT879639	hsa-miR-572	CLIP-seq
MIRT879640	hsa-miR-576-3p	CLIP-seq
MIRT879641	hsa-miR-576-5p	CLIP-seq
MIRT879642	hsa-miR-580	CLIP-seq
MIRT879643	hsa-miR-581	CLIP-seq
MIRT879644	hsa-miR-583	CLIP-seq
MIRT879645	hsa-miR-592	CLIP-seq
MIRT879646	hsa-miR-593	CLIP-seq
MIRT879647	hsa-miR-597	CLIP-seq
MIRT879648	hsa-miR-599	CLIP-seq
MIRT879649	hsa-miR-603	CLIP-seq
MIRT879650	hsa-miR-604	CLIP-seq
MIRT879651	hsa-miR-612	CLIP-seq
MIRT879652	hsa-miR-617	CLIP-seq
MIRT879653	hsa-miR-619	CLIP-seq
MIRT879654	hsa-miR-634	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879656	hsa-miR-637	CLIP-seq
MIRT879657	hsa-miR-646	CLIP-seq
MIRT879658	hsa-miR-647	CLIP-seq
MIRT879659	hsa-miR-650	CLIP-seq
MIRT879660	hsa-miR-654-3p	CLIP-seq
MIRT879661	hsa-miR-661	CLIP-seq
MIRT879662	hsa-miR-663b	CLIP-seq
MIRT879663	hsa-miR-665	CLIP-seq
MIRT879664	hsa-miR-759	CLIP-seq
MIRT879665	hsa-miR-764	CLIP-seq
MIRT879666	hsa-miR-766	CLIP-seq
MIRT879667	hsa-miR-767-5p	CLIP-seq
MIRT879668	hsa-miR-769-5p	CLIP-seq
MIRT879669	hsa-miR-875-3p	CLIP-seq
MIRT879670	hsa-miR-888	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879672	hsa-miR-9	CLIP-seq
MIRT879673	hsa-miR-920	CLIP-seq
MIRT879674	hsa-miR-92a	CLIP-seq
MIRT879675	hsa-miR-92b	CLIP-seq
MIRT879676	hsa-miR-939	CLIP-seq
MIRT879677	hsa-miR-98	CLIP-seq
MIRT879355	hsa-let-7a	CLIP-seq
MIRT879356	hsa-let-7b	CLIP-seq
MIRT879357	hsa-let-7c	CLIP-seq
MIRT879358	hsa-let-7d	CLIP-seq
MIRT879359	hsa-let-7e	CLIP-seq
MIRT879360	hsa-let-7f	CLIP-seq
MIRT879361	hsa-let-7g	CLIP-seq
MIRT879362	hsa-let-7i	CLIP-seq
MIRT879363	hsa-miR-103a	CLIP-seq
MIRT1960660	hsa-miR-106a	CLIP-seq
MIRT1960661	hsa-miR-106b	CLIP-seq
MIRT879364	hsa-miR-107	CLIP-seq
MIRT879367	hsa-miR-1184	CLIP-seq
MIRT879368	hsa-miR-1202	CLIP-seq
MIRT879370	hsa-miR-1224-3p	CLIP-seq
MIRT879371	hsa-miR-1225-3p	CLIP-seq
MIRT879374	hsa-miR-1228	CLIP-seq
MIRT879375	hsa-miR-1233	CLIP-seq
MIRT879376	hsa-miR-1237	CLIP-seq
MIRT879377	hsa-miR-1243	CLIP-seq
MIRT879379	hsa-miR-1262	CLIP-seq
MIRT879381	hsa-miR-1273e	CLIP-seq
MIRT879382	hsa-miR-1275	CLIP-seq
MIRT879383	hsa-miR-1276	CLIP-seq
MIRT879384	hsa-miR-1285	CLIP-seq
MIRT879386	hsa-miR-1299	CLIP-seq
MIRT879387	hsa-miR-1304	CLIP-seq
MIRT879389	hsa-miR-136	CLIP-seq
MIRT1960662	hsa-miR-138	CLIP-seq
MIRT879390	hsa-miR-139-5p	CLIP-seq
MIRT1960663	hsa-miR-142-5p	CLIP-seq
MIRT879391	hsa-miR-143	CLIP-seq
MIRT1960664	hsa-miR-146a	CLIP-seq
MIRT1960665	hsa-miR-146b-5p	CLIP-seq
MIRT1960666	hsa-miR-17	CLIP-seq
MIRT1960667	hsa-miR-185	CLIP-seq
MIRT879392	hsa-miR-18a	CLIP-seq
MIRT879393	hsa-miR-18b	CLIP-seq
MIRT879394	hsa-miR-1909	CLIP-seq
MIRT879395	hsa-miR-1911	CLIP-seq
MIRT1960668	hsa-miR-1915	CLIP-seq
MIRT879398	hsa-miR-1976	CLIP-seq
MIRT879400	hsa-miR-202	CLIP-seq
MIRT879402	hsa-miR-208a	CLIP-seq
MIRT879403	hsa-miR-208b	CLIP-seq
MIRT1960669	hsa-miR-20a	CLIP-seq
MIRT1960670	hsa-miR-20b	CLIP-seq
MIRT879404	hsa-miR-2110	CLIP-seq
MIRT879405	hsa-miR-2116	CLIP-seq
MIRT879406	hsa-miR-217	CLIP-seq
MIRT879407	hsa-miR-219-1-3p	CLIP-seq
MIRT879408	hsa-miR-219-2-3p	CLIP-seq
MIRT879410	hsa-miR-22	CLIP-seq
MIRT879411	hsa-miR-224	CLIP-seq
MIRT879412	hsa-miR-2276	CLIP-seq
MIRT879417	hsa-miR-2467-3p	CLIP-seq
MIRT879418	hsa-miR-25	CLIP-seq
MIRT879420	hsa-miR-2964a-3p	CLIP-seq
MIRT879421	hsa-miR-298	CLIP-seq
MIRT879422	hsa-miR-3065-3p	CLIP-seq
MIRT879424	hsa-miR-3074-3p	CLIP-seq
MIRT879425	hsa-miR-3120-5p	CLIP-seq
MIRT879426	hsa-miR-3126-5p	CLIP-seq
MIRT879429	hsa-miR-3145-3p	CLIP-seq
MIRT879430	hsa-miR-3150a-3p	CLIP-seq
MIRT879431	hsa-miR-3155	CLIP-seq
MIRT879432	hsa-miR-3155b	CLIP-seq
MIRT879434	hsa-miR-3160-3p	CLIP-seq
MIRT1960671	hsa-miR-3162-3p	CLIP-seq
MIRT1960672	hsa-miR-3173-3p	CLIP-seq
MIRT879436	hsa-miR-3180-5p	CLIP-seq
MIRT879437	hsa-miR-3182	CLIP-seq
MIRT879439	hsa-miR-3187-5p	CLIP-seq
MIRT879440	hsa-miR-3192	CLIP-seq
MIRT879441	hsa-miR-32	CLIP-seq
MIRT879442	hsa-miR-320a	CLIP-seq
MIRT879443	hsa-miR-320b	CLIP-seq
MIRT879444	hsa-miR-320c	CLIP-seq
MIRT879445	hsa-miR-320d	CLIP-seq
MIRT879446	hsa-miR-323b-3p	CLIP-seq
MIRT1960673	hsa-miR-324-5p	CLIP-seq
MIRT879447	hsa-miR-326	CLIP-seq
MIRT879448	hsa-miR-329	CLIP-seq
MIRT1960674	hsa-miR-330-3p	CLIP-seq
MIRT879449	hsa-miR-330-5p	CLIP-seq
MIRT1960675	hsa-miR-340	CLIP-seq
MIRT879452	hsa-miR-3529	CLIP-seq
MIRT879453	hsa-miR-3545-3p	CLIP-seq
MIRT879454	hsa-miR-3607-3p	CLIP-seq
MIRT879455	hsa-miR-3609	CLIP-seq
MIRT879456	hsa-miR-3612	CLIP-seq
MIRT879457	hsa-miR-3613-3p	CLIP-seq
MIRT879458	hsa-miR-3614-5p	CLIP-seq
MIRT879460	hsa-miR-361-5p	CLIP-seq
MIRT879461	hsa-miR-3622a-5p	CLIP-seq
MIRT879462	hsa-miR-362-3p	CLIP-seq
MIRT879463	hsa-miR-363	CLIP-seq
MIRT879464	hsa-miR-3653	CLIP-seq
MIRT879465	hsa-miR-3658	CLIP-seq
MIRT879467	hsa-miR-3664-5p	CLIP-seq
MIRT879469	hsa-miR-3667-3p	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879471	hsa-miR-367	CLIP-seq
MIRT879472	hsa-miR-3672	CLIP-seq
MIRT879473	hsa-miR-3686	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879476	hsa-miR-3690	CLIP-seq
MIRT879477	hsa-miR-3692	CLIP-seq
MIRT879478	hsa-miR-3714	CLIP-seq
MIRT879479	hsa-miR-371b-5p	CLIP-seq
MIRT879480	hsa-miR-376a	CLIP-seq
MIRT879481	hsa-miR-376b	CLIP-seq
MIRT879482	hsa-miR-378g	CLIP-seq
MIRT879483	hsa-miR-379	CLIP-seq
MIRT879484	hsa-miR-382	CLIP-seq
MIRT879485	hsa-miR-3913-3p	CLIP-seq
MIRT879486	hsa-miR-3919	CLIP-seq
MIRT1960676	hsa-miR-3925-5p	CLIP-seq
MIRT879487	hsa-miR-3927	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879489	hsa-miR-3942-3p	CLIP-seq
MIRT879490	hsa-miR-3972	CLIP-seq
MIRT1960677	hsa-miR-3977	CLIP-seq
MIRT879491	hsa-miR-411	CLIP-seq
MIRT879492	hsa-miR-4254	CLIP-seq
MIRT879494	hsa-miR-4260	CLIP-seq
MIRT879495	hsa-miR-4263	CLIP-seq
MIRT879497	hsa-miR-4269	CLIP-seq
MIRT879499	hsa-miR-4273	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT1960678	hsa-miR-4306	CLIP-seq
MIRT879505	hsa-miR-4310	CLIP-seq
MIRT879506	hsa-miR-4311	CLIP-seq
MIRT879507	hsa-miR-4314	CLIP-seq
MIRT879508	hsa-miR-4320	CLIP-seq
MIRT879509	hsa-miR-4328	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879512	hsa-miR-4423-3p	CLIP-seq
MIRT879513	hsa-miR-4426	CLIP-seq
MIRT879514	hsa-miR-4429	CLIP-seq
MIRT879515	hsa-miR-4433	CLIP-seq
MIRT879518	hsa-miR-4443	CLIP-seq
MIRT879521	hsa-miR-4450	CLIP-seq
MIRT879522	hsa-miR-4452	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT1960679	hsa-miR-4456	CLIP-seq
MIRT879524	hsa-miR-4458	CLIP-seq
MIRT879525	hsa-miR-4459	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879528	hsa-miR-4486	CLIP-seq
MIRT879529	hsa-miR-4487	CLIP-seq
MIRT879531	hsa-miR-4500	CLIP-seq
MIRT879532	hsa-miR-4502	CLIP-seq
MIRT879533	hsa-miR-4505	CLIP-seq
MIRT879535	hsa-miR-451b	CLIP-seq
MIRT1960680	hsa-miR-4534	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879540	hsa-miR-4637	CLIP-seq
MIRT879542	hsa-miR-4639-5p	CLIP-seq
MIRT879543	hsa-miR-4640-3p	CLIP-seq
MIRT879544	hsa-miR-4641	CLIP-seq
MIRT879545	hsa-miR-4643	CLIP-seq
MIRT1960681	hsa-miR-4644	CLIP-seq
MIRT879546	hsa-miR-4646-5p	CLIP-seq
MIRT879547	hsa-miR-4647	CLIP-seq
MIRT1960682	hsa-miR-4649-5p	CLIP-seq
MIRT1960683	hsa-miR-4650-5p	CLIP-seq
MIRT879548	hsa-miR-4652-3p	CLIP-seq
MIRT879549	hsa-miR-4659a-3p	CLIP-seq
MIRT879550	hsa-miR-4659b-3p	CLIP-seq
MIRT879551	hsa-miR-4660	CLIP-seq
MIRT879552	hsa-miR-4662b	CLIP-seq
MIRT879553	hsa-miR-4665-5p	CLIP-seq
MIRT879556	hsa-miR-4677-5p	CLIP-seq
MIRT879557	hsa-miR-4679	CLIP-seq
MIRT1960684	hsa-miR-4680-3p	CLIP-seq
MIRT879559	hsa-miR-4690-5p	CLIP-seq
MIRT879561	hsa-miR-4691-5p	CLIP-seq
MIRT879562	hsa-miR-4693-3p	CLIP-seq
MIRT1960685	hsa-miR-4695-5p	CLIP-seq
MIRT879563	hsa-miR-4696	CLIP-seq
MIRT879565	hsa-miR-4701-3p	CLIP-seq
MIRT1960686	hsa-miR-4705	CLIP-seq
MIRT879567	hsa-miR-4708-3p	CLIP-seq
MIRT879568	hsa-miR-4711-5p	CLIP-seq
MIRT879570	hsa-miR-4714-5p	CLIP-seq
MIRT879572	hsa-miR-4719	CLIP-seq
MIRT879573	hsa-miR-4722-3p	CLIP-seq
MIRT1960687	hsa-miR-4726-3p	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879577	hsa-miR-4731-3p	CLIP-seq
MIRT879578	hsa-miR-4731-5p	CLIP-seq
MIRT879579	hsa-miR-4733-5p	CLIP-seq
MIRT879580	hsa-miR-4735-3p	CLIP-seq
MIRT879582	hsa-miR-4738-3p	CLIP-seq
MIRT879584	hsa-miR-4755-3p	CLIP-seq
MIRT879585	hsa-miR-4756-3p	CLIP-seq
MIRT879586	hsa-miR-4761-5p	CLIP-seq
MIRT879587	hsa-miR-4762-3p	CLIP-seq
MIRT879590	hsa-miR-4768-3p	CLIP-seq
MIRT879591	hsa-miR-4769-3p	CLIP-seq
MIRT879592	hsa-miR-4770	CLIP-seq
MIRT879593	hsa-miR-4772-3p	CLIP-seq
MIRT879596	hsa-miR-4782-5p	CLIP-seq
MIRT1960688	hsa-miR-4786-3p	CLIP-seq
MIRT879597	hsa-miR-4786-5p	CLIP-seq
MIRT879598	hsa-miR-4789-5p	CLIP-seq
MIRT879599	hsa-miR-4793-3p	CLIP-seq
MIRT879600	hsa-miR-4793-5p	CLIP-seq
MIRT1960689	hsa-miR-4796-3p	CLIP-seq
MIRT879601	hsa-miR-4801	CLIP-seq
MIRT879602	hsa-miR-4802-3p	CLIP-seq
MIRT879603	hsa-miR-4802-5p	CLIP-seq
MIRT879604	hsa-miR-484	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879606	hsa-miR-499-3p	CLIP-seq
MIRT879607	hsa-miR-499-5p	CLIP-seq
MIRT879608	hsa-miR-499a-3p	CLIP-seq
MIRT879611	hsa-miR-508-5p	CLIP-seq
MIRT879612	hsa-miR-510	CLIP-seq
MIRT879613	hsa-miR-511	CLIP-seq
MIRT879614	hsa-miR-512-5p	CLIP-seq
MIRT879615	hsa-miR-515-5p	CLIP-seq
MIRT879617	hsa-miR-516b	CLIP-seq
MIRT1960690	hsa-miR-519d	CLIP-seq
MIRT879618	hsa-miR-520a-5p	CLIP-seq
MIRT879619	hsa-miR-525-5p	CLIP-seq
MIRT1960691	hsa-miR-541	CLIP-seq
MIRT879621	hsa-miR-544	CLIP-seq
MIRT879624	hsa-miR-548ah	CLIP-seq
MIRT879625	hsa-miR-548an	CLIP-seq
MIRT879626	hsa-miR-548c-3p	CLIP-seq
MIRT879628	hsa-miR-548g	CLIP-seq
MIRT879629	hsa-miR-548m	CLIP-seq
MIRT879631	hsa-miR-548o	CLIP-seq
MIRT879632	hsa-miR-548t	CLIP-seq
MIRT879634	hsa-miR-550b	CLIP-seq
MIRT879636	hsa-miR-558	CLIP-seq
MIRT879637	hsa-miR-561	CLIP-seq
MIRT879639	hsa-miR-572	CLIP-seq
MIRT879642	hsa-miR-580	CLIP-seq
MIRT879643	hsa-miR-581	CLIP-seq
MIRT1960692	hsa-miR-582-5p	CLIP-seq
MIRT879644	hsa-miR-583	CLIP-seq
MIRT879645	hsa-miR-592	CLIP-seq
MIRT879646	hsa-miR-593	CLIP-seq
MIRT879647	hsa-miR-597	CLIP-seq
MIRT879648	hsa-miR-599	CLIP-seq
MIRT879649	hsa-miR-603	CLIP-seq
MIRT879650	hsa-miR-604	CLIP-seq
MIRT1960693	hsa-miR-610	CLIP-seq
MIRT879651	hsa-miR-612	CLIP-seq
MIRT879653	hsa-miR-619	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879657	hsa-miR-646	CLIP-seq
MIRT879658	hsa-miR-647	CLIP-seq
MIRT879659	hsa-miR-650	CLIP-seq
MIRT879660	hsa-miR-654-3p	CLIP-seq
MIRT1960694	hsa-miR-654-5p	CLIP-seq
MIRT879661	hsa-miR-661	CLIP-seq
MIRT879663	hsa-miR-665	CLIP-seq
MIRT1960695	hsa-miR-671-5p	CLIP-seq
MIRT879664	hsa-miR-759	CLIP-seq
MIRT879666	hsa-miR-766	CLIP-seq
MIRT879667	hsa-miR-767-5p	CLIP-seq
MIRT879668	hsa-miR-769-5p	CLIP-seq
MIRT879669	hsa-miR-875-3p	CLIP-seq
MIRT879670	hsa-miR-888	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879672	hsa-miR-9	CLIP-seq
MIRT879674	hsa-miR-92a	CLIP-seq
MIRT879675	hsa-miR-92b	CLIP-seq
MIRT1960696	hsa-miR-93	CLIP-seq
MIRT879677	hsa-miR-98	CLIP-seq
MIRT879355	hsa-let-7a	CLIP-seq
MIRT879356	hsa-let-7b	CLIP-seq
MIRT879357	hsa-let-7c	CLIP-seq
MIRT879358	hsa-let-7d	CLIP-seq
MIRT879359	hsa-let-7e	CLIP-seq
MIRT879360	hsa-let-7f	CLIP-seq
MIRT879361	hsa-let-7g	CLIP-seq
MIRT879362	hsa-let-7i	CLIP-seq
MIRT879363	hsa-miR-103a	CLIP-seq
MIRT1960660	hsa-miR-106a	CLIP-seq
MIRT1960661	hsa-miR-106b	CLIP-seq
MIRT879364	hsa-miR-107	CLIP-seq
MIRT879367	hsa-miR-1184	CLIP-seq
MIRT879368	hsa-miR-1202	CLIP-seq
MIRT879369	hsa-miR-1207-5p	CLIP-seq
MIRT879370	hsa-miR-1224-3p	CLIP-seq
MIRT879371	hsa-miR-1225-3p	CLIP-seq
MIRT879372	hsa-miR-1225-5p	CLIP-seq
MIRT879373	hsa-miR-1226	CLIP-seq
MIRT879374	hsa-miR-1228	CLIP-seq
MIRT879375	hsa-miR-1233	CLIP-seq
MIRT879376	hsa-miR-1237	CLIP-seq
MIRT879377	hsa-miR-1243	CLIP-seq
MIRT879379	hsa-miR-1262	CLIP-seq
MIRT879381	hsa-miR-1273e	CLIP-seq
MIRT879382	hsa-miR-1275	CLIP-seq
MIRT879384	hsa-miR-1285	CLIP-seq
MIRT879387	hsa-miR-1304	CLIP-seq
MIRT879388	hsa-miR-1305	CLIP-seq
MIRT879389	hsa-miR-136	CLIP-seq
MIRT1960662	hsa-miR-138	CLIP-seq
MIRT879390	hsa-miR-139-5p	CLIP-seq
MIRT1960663	hsa-miR-142-5p	CLIP-seq
MIRT879391	hsa-miR-143	CLIP-seq
MIRT1960664	hsa-miR-146a	CLIP-seq
MIRT1960665	hsa-miR-146b-5p	CLIP-seq
MIRT1960666	hsa-miR-17	CLIP-seq
MIRT1960667	hsa-miR-185	CLIP-seq
MIRT879392	hsa-miR-18a	CLIP-seq
MIRT879393	hsa-miR-18b	CLIP-seq
MIRT879394	hsa-miR-1909	CLIP-seq
MIRT879395	hsa-miR-1911	CLIP-seq
MIRT1960668	hsa-miR-1915	CLIP-seq
MIRT879397	hsa-miR-197	CLIP-seq
MIRT879398	hsa-miR-1976	CLIP-seq
MIRT879400	hsa-miR-202	CLIP-seq
MIRT879402	hsa-miR-208a	CLIP-seq
MIRT879403	hsa-miR-208b	CLIP-seq
MIRT1960669	hsa-miR-20a	CLIP-seq
MIRT1960670	hsa-miR-20b	CLIP-seq
MIRT879404	hsa-miR-2110	CLIP-seq
MIRT879405	hsa-miR-2116	CLIP-seq
MIRT879406	hsa-miR-217	CLIP-seq
MIRT879407	hsa-miR-219-1-3p	CLIP-seq
MIRT879408	hsa-miR-219-2-3p	CLIP-seq
MIRT879409	hsa-miR-219-5p	CLIP-seq
MIRT879410	hsa-miR-22	CLIP-seq
MIRT879411	hsa-miR-224	CLIP-seq
MIRT879412	hsa-miR-2276	CLIP-seq
MIRT879416	hsa-miR-24	CLIP-seq
MIRT879418	hsa-miR-25	CLIP-seq
MIRT879420	hsa-miR-2964a-3p	CLIP-seq
MIRT879421	hsa-miR-298	CLIP-seq
MIRT879422	hsa-miR-3065-3p	CLIP-seq
MIRT879423	hsa-miR-3065-5p	CLIP-seq
MIRT879424	hsa-miR-3074-3p	CLIP-seq
MIRT879425	hsa-miR-3120-5p	CLIP-seq
MIRT879428	hsa-miR-3137	CLIP-seq
MIRT879429	hsa-miR-3145-3p	CLIP-seq
MIRT879430	hsa-miR-3150a-3p	CLIP-seq
MIRT879431	hsa-miR-3155	CLIP-seq
MIRT879432	hsa-miR-3155b	CLIP-seq
MIRT879433	hsa-miR-3157-5p	CLIP-seq
MIRT879434	hsa-miR-3160-3p	CLIP-seq
MIRT1960672	hsa-miR-3173-3p	CLIP-seq
MIRT879435	hsa-miR-3175	CLIP-seq
MIRT879436	hsa-miR-3180-5p	CLIP-seq
MIRT879437	hsa-miR-3182	CLIP-seq
MIRT879439	hsa-miR-3187-5p	CLIP-seq
MIRT879440	hsa-miR-3192	CLIP-seq
MIRT879441	hsa-miR-32	CLIP-seq
MIRT879442	hsa-miR-320a	CLIP-seq
MIRT879443	hsa-miR-320b	CLIP-seq
MIRT879444	hsa-miR-320c	CLIP-seq
MIRT879445	hsa-miR-320d	CLIP-seq
MIRT879446	hsa-miR-323b-3p	CLIP-seq
MIRT1960673	hsa-miR-324-5p	CLIP-seq
MIRT879447	hsa-miR-326	CLIP-seq
MIRT1960674	hsa-miR-330-3p	CLIP-seq
MIRT879449	hsa-miR-330-5p	CLIP-seq
MIRT879450	hsa-miR-338-3p	CLIP-seq
MIRT1960675	hsa-miR-340	CLIP-seq
MIRT879452	hsa-miR-3529	CLIP-seq
MIRT879453	hsa-miR-3545-3p	CLIP-seq
MIRT879454	hsa-miR-3607-3p	CLIP-seq
MIRT879455	hsa-miR-3609	CLIP-seq
MIRT879456	hsa-miR-3612	CLIP-seq
MIRT879457	hsa-miR-3613-3p	CLIP-seq
MIRT879458	hsa-miR-3614-5p	CLIP-seq
MIRT879460	hsa-miR-361-5p	CLIP-seq
MIRT879461	hsa-miR-3622a-5p	CLIP-seq
MIRT879463	hsa-miR-363	CLIP-seq
MIRT879465	hsa-miR-3658	CLIP-seq
MIRT879466	hsa-miR-3664-3p	CLIP-seq
MIRT879467	hsa-miR-3664-5p	CLIP-seq
MIRT879468	hsa-miR-3665	CLIP-seq
MIRT879469	hsa-miR-3667-3p	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879471	hsa-miR-367	CLIP-seq
MIRT879472	hsa-miR-3672	CLIP-seq
MIRT879473	hsa-miR-3686	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879476	hsa-miR-3690	CLIP-seq
MIRT879477	hsa-miR-3692	CLIP-seq
MIRT879478	hsa-miR-3714	CLIP-seq
MIRT879479	hsa-miR-371b-5p	CLIP-seq
MIRT879482	hsa-miR-378g	CLIP-seq
MIRT879483	hsa-miR-379	CLIP-seq
MIRT879484	hsa-miR-382	CLIP-seq
MIRT879485	hsa-miR-3913-3p	CLIP-seq
MIRT879486	hsa-miR-3919	CLIP-seq
MIRT1960676	hsa-miR-3925-5p	CLIP-seq
MIRT879487	hsa-miR-3927	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879489	hsa-miR-3942-3p	CLIP-seq
MIRT879490	hsa-miR-3972	CLIP-seq
MIRT1960677	hsa-miR-3977	CLIP-seq
MIRT879491	hsa-miR-411	CLIP-seq
MIRT879492	hsa-miR-4254	CLIP-seq
MIRT879493	hsa-miR-4259	CLIP-seq
MIRT879494	hsa-miR-4260	CLIP-seq
MIRT879495	hsa-miR-4263	CLIP-seq
MIRT879497	hsa-miR-4269	CLIP-seq
MIRT879498	hsa-miR-4270	CLIP-seq
MIRT879499	hsa-miR-4273	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879502	hsa-miR-4282	CLIP-seq
MIRT879503	hsa-miR-4284	CLIP-seq
MIRT879504	hsa-miR-4300	CLIP-seq
MIRT1960678	hsa-miR-4306	CLIP-seq
MIRT879505	hsa-miR-4310	CLIP-seq
MIRT879507	hsa-miR-4314	CLIP-seq
MIRT879508	hsa-miR-4320	CLIP-seq
MIRT2197341	hsa-miR-4323	CLIP-seq
MIRT879509	hsa-miR-4328	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879512	hsa-miR-4423-3p	CLIP-seq
MIRT879513	hsa-miR-4426	CLIP-seq
MIRT879514	hsa-miR-4429	CLIP-seq
MIRT879515	hsa-miR-4433	CLIP-seq
MIRT879517	hsa-miR-4441	CLIP-seq
MIRT879518	hsa-miR-4443	CLIP-seq
MIRT879519	hsa-miR-4445	CLIP-seq
MIRT879521	hsa-miR-4450	CLIP-seq
MIRT879522	hsa-miR-4452	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT1960679	hsa-miR-4456	CLIP-seq
MIRT879524	hsa-miR-4458	CLIP-seq
MIRT879525	hsa-miR-4459	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879528	hsa-miR-4486	CLIP-seq
MIRT879529	hsa-miR-4487	CLIP-seq
MIRT879530	hsa-miR-4495	CLIP-seq
MIRT879531	hsa-miR-4500	CLIP-seq
MIRT879532	hsa-miR-4502	CLIP-seq
MIRT879533	hsa-miR-4505	CLIP-seq
MIRT879535	hsa-miR-451b	CLIP-seq
MIRT879536	hsa-miR-4520a-3p	CLIP-seq
MIRT879537	hsa-miR-4520b-3p	CLIP-seq
MIRT879538	hsa-miR-4529-3p	CLIP-seq
MIRT1960680	hsa-miR-4534	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879540	hsa-miR-4637	CLIP-seq
MIRT879541	hsa-miR-4639-3p	CLIP-seq
MIRT879542	hsa-miR-4639-5p	CLIP-seq
MIRT879544	hsa-miR-4641	CLIP-seq
MIRT879545	hsa-miR-4643	CLIP-seq
MIRT1960681	hsa-miR-4644	CLIP-seq
MIRT879546	hsa-miR-4646-5p	CLIP-seq
MIRT879547	hsa-miR-4647	CLIP-seq
MIRT1960682	hsa-miR-4649-5p	CLIP-seq
MIRT1960683	hsa-miR-4650-5p	CLIP-seq
MIRT879548	hsa-miR-4652-3p	CLIP-seq
MIRT879549	hsa-miR-4659a-3p	CLIP-seq
MIRT879550	hsa-miR-4659b-3p	CLIP-seq
MIRT879551	hsa-miR-4660	CLIP-seq
MIRT879552	hsa-miR-4662b	CLIP-seq
MIRT879553	hsa-miR-4665-5p	CLIP-seq
MIRT879555	hsa-miR-4672	CLIP-seq
MIRT879556	hsa-miR-4677-5p	CLIP-seq
MIRT879557	hsa-miR-4679	CLIP-seq
MIRT1960684	hsa-miR-4680-3p	CLIP-seq
MIRT879558	hsa-miR-4684-5p	CLIP-seq
MIRT879559	hsa-miR-4690-5p	CLIP-seq
MIRT879560	hsa-miR-4691-3p	CLIP-seq
MIRT879561	hsa-miR-4691-5p	CLIP-seq
MIRT879562	hsa-miR-4693-3p	CLIP-seq
MIRT1960685	hsa-miR-4695-5p	CLIP-seq
MIRT879563	hsa-miR-4696	CLIP-seq
MIRT879565	hsa-miR-4701-3p	CLIP-seq
MIRT1960686	hsa-miR-4705	CLIP-seq
MIRT879567	hsa-miR-4708-3p	CLIP-seq
MIRT879568	hsa-miR-4711-5p	CLIP-seq
MIRT879570	hsa-miR-4714-5p	CLIP-seq
MIRT879573	hsa-miR-4722-3p	CLIP-seq
MIRT1960687	hsa-miR-4726-3p	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879577	hsa-miR-4731-3p	CLIP-seq
MIRT879578	hsa-miR-4731-5p	CLIP-seq
MIRT879579	hsa-miR-4733-5p	CLIP-seq
MIRT879580	hsa-miR-4735-3p	CLIP-seq
MIRT879581	hsa-miR-4736	CLIP-seq
MIRT879582	hsa-miR-4738-3p	CLIP-seq
MIRT879584	hsa-miR-4755-3p	CLIP-seq
MIRT879585	hsa-miR-4756-3p	CLIP-seq
MIRT879586	hsa-miR-4761-5p	CLIP-seq
MIRT879587	hsa-miR-4762-3p	CLIP-seq
MIRT879588	hsa-miR-4763-3p	CLIP-seq
MIRT879590	hsa-miR-4768-3p	CLIP-seq
MIRT879591	hsa-miR-4769-3p	CLIP-seq
MIRT879592	hsa-miR-4770	CLIP-seq
MIRT879593	hsa-miR-4772-3p	CLIP-seq
MIRT879595	hsa-miR-4782-3p	CLIP-seq
MIRT1960688	hsa-miR-4786-3p	CLIP-seq
MIRT879597	hsa-miR-4786-5p	CLIP-seq
MIRT879598	hsa-miR-4789-5p	CLIP-seq
MIRT879599	hsa-miR-4793-3p	CLIP-seq
MIRT879600	hsa-miR-4793-5p	CLIP-seq
MIRT1960689	hsa-miR-4796-3p	CLIP-seq
MIRT879601	hsa-miR-4801	CLIP-seq
MIRT879602	hsa-miR-4802-3p	CLIP-seq
MIRT879603	hsa-miR-4802-5p	CLIP-seq
MIRT879604	hsa-miR-484	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879606	hsa-miR-499-3p	CLIP-seq
MIRT879607	hsa-miR-499-5p	CLIP-seq
MIRT879608	hsa-miR-499a-3p	CLIP-seq
MIRT879610	hsa-miR-508-3p	CLIP-seq
MIRT879611	hsa-miR-508-5p	CLIP-seq
MIRT879612	hsa-miR-510	CLIP-seq
MIRT879613	hsa-miR-511	CLIP-seq
MIRT879614	hsa-miR-512-5p	CLIP-seq
MIRT879615	hsa-miR-515-5p	CLIP-seq
MIRT1960690	hsa-miR-519d	CLIP-seq
MIRT879618	hsa-miR-520a-5p	CLIP-seq
MIRT879619	hsa-miR-525-5p	CLIP-seq
MIRT879620	hsa-miR-539	CLIP-seq
MIRT1960691	hsa-miR-541	CLIP-seq
MIRT879621	hsa-miR-544	CLIP-seq
MIRT879622	hsa-miR-548aa	CLIP-seq
MIRT879623	hsa-miR-548ac	CLIP-seq
MIRT879624	hsa-miR-548ah	CLIP-seq
MIRT879626	hsa-miR-548c-3p	CLIP-seq
MIRT879627	hsa-miR-548d-3p	CLIP-seq
MIRT879628	hsa-miR-548g	CLIP-seq
MIRT879629	hsa-miR-548m	CLIP-seq
MIRT879631	hsa-miR-548o	CLIP-seq
MIRT879632	hsa-miR-548t	CLIP-seq
MIRT879633	hsa-miR-548z	CLIP-seq
MIRT879634	hsa-miR-550b	CLIP-seq
MIRT879635	hsa-miR-555	CLIP-seq
MIRT879636	hsa-miR-558	CLIP-seq
MIRT879637	hsa-miR-561	CLIP-seq
MIRT879638	hsa-miR-571	CLIP-seq
MIRT879639	hsa-miR-572	CLIP-seq
MIRT879642	hsa-miR-580	CLIP-seq
MIRT879643	hsa-miR-581	CLIP-seq
MIRT1960692	hsa-miR-582-5p	CLIP-seq
MIRT879644	hsa-miR-583	CLIP-seq
MIRT879645	hsa-miR-592	CLIP-seq
MIRT879646	hsa-miR-593	CLIP-seq
MIRT879647	hsa-miR-597	CLIP-seq
MIRT879648	hsa-miR-599	CLIP-seq
MIRT879649	hsa-miR-603	CLIP-seq
MIRT879650	hsa-miR-604	CLIP-seq
MIRT1960693	hsa-miR-610	CLIP-seq
MIRT879651	hsa-miR-612	CLIP-seq
MIRT879653	hsa-miR-619	CLIP-seq
MIRT879654	hsa-miR-634	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879657	hsa-miR-646	CLIP-seq
MIRT879658	hsa-miR-647	CLIP-seq
MIRT879659	hsa-miR-650	CLIP-seq
MIRT879660	hsa-miR-654-3p	CLIP-seq
MIRT1960694	hsa-miR-654-5p	CLIP-seq
MIRT879661	hsa-miR-661	CLIP-seq
MIRT879663	hsa-miR-665	CLIP-seq
MIRT1960695	hsa-miR-671-5p	CLIP-seq
MIRT879664	hsa-miR-759	CLIP-seq
MIRT879665	hsa-miR-764	CLIP-seq
MIRT879667	hsa-miR-767-5p	CLIP-seq
MIRT879668	hsa-miR-769-5p	CLIP-seq
MIRT879670	hsa-miR-888	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879672	hsa-miR-9	CLIP-seq
MIRT879673	hsa-miR-920	CLIP-seq
MIRT879674	hsa-miR-92a	CLIP-seq
MIRT879675	hsa-miR-92b	CLIP-seq
MIRT1960696	hsa-miR-93	CLIP-seq
MIRT879676	hsa-miR-939	CLIP-seq
MIRT879677	hsa-miR-98	CLIP-seq
MIRT879371	hsa-miR-1225-3p	CLIP-seq
MIRT879375	hsa-miR-1233	CLIP-seq
MIRT879381	hsa-miR-1273e	CLIP-seq
MIRT879387	hsa-miR-1304	CLIP-seq
MIRT879402	hsa-miR-208a	CLIP-seq
MIRT879403	hsa-miR-208b	CLIP-seq
MIRT879418	hsa-miR-25	CLIP-seq
MIRT879421	hsa-miR-298	CLIP-seq
MIRT879434	hsa-miR-3160-3p	CLIP-seq
MIRT879440	hsa-miR-3192	CLIP-seq
MIRT879441	hsa-miR-32	CLIP-seq
MIRT879446	hsa-miR-323b-3p	CLIP-seq
MIRT879447	hsa-miR-326	CLIP-seq
MIRT879449	hsa-miR-330-5p	CLIP-seq
MIRT879454	hsa-miR-3607-3p	CLIP-seq
MIRT879463	hsa-miR-363	CLIP-seq
MIRT879465	hsa-miR-3658	CLIP-seq
MIRT879467	hsa-miR-3664-5p	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879471	hsa-miR-367	CLIP-seq
MIRT879473	hsa-miR-3686	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879507	hsa-miR-4314	CLIP-seq
MIRT879515	hsa-miR-4433	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT879529	hsa-miR-4487	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879546	hsa-miR-4646-5p	CLIP-seq
MIRT879557	hsa-miR-4679	CLIP-seq
MIRT879568	hsa-miR-4711-5p	CLIP-seq
MIRT879570	hsa-miR-4714-5p	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879579	hsa-miR-4733-5p	CLIP-seq
MIRT879598	hsa-miR-4789-5p	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879607	hsa-miR-499-5p	CLIP-seq
MIRT879626	hsa-miR-548c-3p	CLIP-seq
MIRT879636	hsa-miR-558	CLIP-seq
MIRT1960692	hsa-miR-582-5p	CLIP-seq
MIRT1960693	hsa-miR-610	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879660	hsa-miR-654-3p	CLIP-seq
MIRT879663	hsa-miR-665	CLIP-seq
MIRT879667	hsa-miR-767-5p	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879674	hsa-miR-92a	CLIP-seq
MIRT879675	hsa-miR-92b	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879371	hsa-miR-1225-3p	CLIP-seq
MIRT879375	hsa-miR-1233	CLIP-seq
MIRT2500599	hsa-miR-2355-5p	CLIP-seq
MIRT879440	hsa-miR-3192	CLIP-seq
MIRT879446	hsa-miR-323b-3p	CLIP-seq
MIRT879447	hsa-miR-326	CLIP-seq
MIRT879449	hsa-miR-330-5p	CLIP-seq
MIRT879454	hsa-miR-3607-3p	CLIP-seq
MIRT879458	hsa-miR-3614-5p	CLIP-seq
MIRT879467	hsa-miR-3664-5p	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879472	hsa-miR-3672	CLIP-seq
MIRT2500600	hsa-miR-3679-3p	CLIP-seq
MIRT879473	hsa-miR-3686	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879507	hsa-miR-4314	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879513	hsa-miR-4426	CLIP-seq
MIRT879515	hsa-miR-4433	CLIP-seq
MIRT2500601	hsa-miR-4446-5p	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879535	hsa-miR-451b	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879546	hsa-miR-4646-5p	CLIP-seq
MIRT879547	hsa-miR-4647	CLIP-seq
MIRT879552	hsa-miR-4662b	CLIP-seq
MIRT879563	hsa-miR-4696	CLIP-seq
MIRT879570	hsa-miR-4714-5p	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879579	hsa-miR-4733-5p	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT2500602	hsa-miR-513c	CLIP-seq
MIRT2500603	hsa-miR-514b-5p	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879660	hsa-miR-654-3p	CLIP-seq
MIRT879663	hsa-miR-665	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq
MIRT879470	hsa-miR-3667-5p	CLIP-seq
MIRT879474	hsa-miR-3689a-3p	CLIP-seq
MIRT879475	hsa-miR-3689c	CLIP-seq
MIRT879488	hsa-miR-3929	CLIP-seq
MIRT879501	hsa-miR-4281	CLIP-seq
MIRT879510	hsa-miR-4419b	CLIP-seq
MIRT879523	hsa-miR-4453	CLIP-seq
MIRT879527	hsa-miR-4478	CLIP-seq
MIRT879535	hsa-miR-451b	CLIP-seq
MIRT879539	hsa-miR-4538	CLIP-seq
MIRT879563	hsa-miR-4696	CLIP-seq
MIRT879576	hsa-miR-4728-5p	CLIP-seq
MIRT879597	hsa-miR-4786-5p	CLIP-seq
MIRT879605	hsa-miR-485-5p	CLIP-seq
MIRT879655	hsa-miR-635	CLIP-seq
MIRT879668	hsa-miR-769-5p	CLIP-seq
MIRT879671	hsa-miR-890	CLIP-seq

Transcription factors

Show/Hide all(59)

Transcription factor	Regulation	Reference
AR	Repression	18794357
CBX7	Activation	19706751
DNMT1	Repression	18049164
DNMT1	Unknown	21846773
ESR1	Unknown	17893710
EZH2	Repression	21685935
FOXA2	Activation	20160041
FOXF1	Unknown	24186199
FOXM1	Unknown	21311221
FOXQ1	Unknown	23403865
GATA3	Activation	20189993
GLI2	Repression	23890107
HDAC1	Repression	18794357;19182791;20580679;21184735;21685935
HDAC1	Unknown	24424621
HDAC2	Repression	19706751;20714342;21685935
HDAC3	Repression	20049841
HDGF	Repression	22247069
HIF1A	Repression	22295844
HMGA1	Repression	22276142
HMGA2	Activation	19179606
HOXA7	Activation	11742062
KLF4	Activation	22407433;23376074
KLF6	Unknown	16702959;22277651
KLF8	Activation	20728449
LCOR	Unknown	22277651
LMO2	Repression	17167821
MTA1	Repression	18719363;24424621
MTA2	Repression	20714342
NFKB1	Activation	20683022
PARP1	Activation	21577210
PARP1	Unknown	18773488
RB1	Unknown	12391156
RBBP7	Repression	20714342
RELA	Activation	20683022
SALL4	Repression	23954296
SIRT1	Repression	21640770;22249256
SIX1	Repression	22286765
SMARCA4	Activation	20418909
SNAI1	Repression	12579345;15311212;16424022;16502042;16617148;16804902;19179606;19874710;19893985;20053763
SNAI1	Unknown	21081648;21796367
SNAI2	Repression	15311212;20053763;22899291
SNAI2	Unknown	21081648;21796367
SPDEF	Activation	23449978
STAT3	Unknown	18320073;22205702
TCF12	Repression	22130667
TCF3	Repression	20053763
TFAP2A	Activation	17224907
TFAP2A	Repression	17224907
TWIST1	Repression	15311212;19581928;20053763;21876555;22899291
TWIST1	Unknown	21796367
TWIST2	Unknown	21796367
VDR	Activation	22213313
WT1	Repression	23298185;23945386
YBX1	Activation	17072343
ZEB1	Activation	19839049
ZEB1	Repression	12161443;15311212;23743934
ZEB1	Unknown	22147512
ZEB2	Repression	11430829;20053763;20682777;22227038;23376074
ZNF217	Repression	17130829

Show/Hide all(89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0002159	Process	Desmosome assembly	IMP	29999492
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10725230, 11401320, 11790773, 12526809, 15695390, 16212417, 16983094, 17220478, 17237808, 17274640, 17715295, 18093941, 18593713, 19016843, 19038973, 19604117, 19732724, 19822757, 20086044, 21685945, 22056988, 22158051, 22252131, 22294297, 22750944, 23086448, 24189400, 24424122, 246
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22294297
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IMP	17620337
GO:0005886	Component	Plasma membrane	IDA	20859650, 28301459
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	16338932, 18343367, 20086044, 22294297, 24046456, 27760340
GO:0005912	Component	Adherens junction	IEA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	NAS	8033105, 16338932
GO:0007416	Process	Synapse assembly	IBA
GO:0007416	Process	Synapse assembly	IEA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IDA	17620337
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	18593713
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	20189993
GO:0010468	Process	Regulation of gene expression	IMP	19403558
GO:0015629	Component	Actin cytoskeleton	IDA	16338932
GO:0016020	Component	Membrane	IDA	16338932
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	16338932, 17620337
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016342	Component	Catenin complex	IDA	18593713
GO:0016477	Process	Cell migration	IBA
GO:0016600	Component	Flotillin complex	IBA
GO:0016600	Component	Flotillin complex	IDA	24046456
GO:0021983	Process	Pituitary gland development	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IMP	19653274
GO:0030027	Component	Lamellipodium	IDA	24046456
GO:0030054	Component	Cell junction	IDA	19038973, 28169360
GO:0030054	Component	Cell junction	IEA
GO:0030054	Component	Cell junction	TAS	17047063
GO:0030057	Component	Desmosome	IDA	29999492
GO:0030057	Component	Desmosome	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	16882694
GO:0030506	Function	Ankyrin binding	IPI	17620337
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IDA	24046456
GO:0031175	Process	Neuron projection development	IEA
GO:0032794	Function	GTPase activating protein binding	IPI	20116244
GO:0034329	Process	Cell junction assembly	IEA
GO:0034332	Process	Adherens junction organization	IBA
GO:0034332	Process	Adherens junction organization	IMP	21724833
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	16338932
GO:0042802	Function	Identical protein binding	IPI	19114658, 19646884, 21300292, 23112161, 24725409
GO:0043296	Component	Apical junction complex	IBA
GO:0043296	Component	Apical junction complex	IDA	10460003
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	18593713
GO:0045295	Function	Gamma-catenin binding	IPI	1639850
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045296	Function	Cadherin binding	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16338932
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16338932
GO:0050839	Function	Cell adhesion molecule binding	IPI	21724833
GO:0050839	Function	Cell adhesion molecule binding	NAS	16338932
GO:0051049	Process	Regulation of transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0071285	Process	Cellular response to lithium ion	IDA	12937339
GO:0071503	Process	Response to heparin	IEA
GO:0071681	Process	Cellular response to indole-3-methanol	IDA	10868478
GO:0072659	Process	Protein localization to plasma membrane	IDA	17620337
GO:0072659	Process	Protein localization to plasma membrane	IMP	20859650
GO:0098609	Process	Cell-cell adhesion	IDA	16338932
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IDA	11976333
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099576	Process	Regulation of protein catabolic process at postsynapse, modulating synaptic transmission	IEA
GO:0140459	Process	Response to Gram-positive bacterium	IEA
GO:1903829	Process	Positive regulation of protein localization	IMP	29999492
GO:1990782	Function	Protein tyrosine kinase binding	IEA

MIM	HGNC	e!Ensembl
192090	1748	ENSG00000039068

Protein

UniProt ID

P12830

Protein name

Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]

Protein function

Cadherins are calcium-dependent cell adhesion proteins (PubMed:11976333). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is

PDB

1O6S , 2O72 , 2OMT , 2OMU , 2OMV , 2OMX , 2OMY , 2OMZ , 3FF7 , 3FF8 , 3L6X , 3L6Y , 4ZT1 , 4ZTE , 6CXY , 6OLE , 6OLF , 6OLG , 6VEL , 7STZ , 8H62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08758	Cadherin_pro	27 → 116	Cadherin prodomain like	Domain
PF00028	Cadherin	159 → 253	Cadherin domain	Domain
PF00028	Cadherin	267 → 366	Cadherin domain	Domain
PF00028	Cadherin	380 → 478	Cadherin domain	Domain
PF00028	Cadherin	491 → 585	Cadherin domain	Domain
PF00028	Cadherin	598 → 686	Cadherin domain	Domain
PF01049	Cadherin_C	733 → 879	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in granuloma macrophages (at protein level) (PubMed:27760340). Expressed in the skin (at protein level) (PubMed:22294297). Expressed in the liver (PubMed:3263290). {ECO:0000269|PubMed:22294297, ECO:0000269|PubMed:27760340, EC

Sequence

MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD

Sequence length

882

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Apelin signaling pathway Hippo signaling pathway Cell adhesion molecules Adherens junction Bacterial invasion of epithelial cells Pathways in cancer Endometrial cancer Thyroid cancer Melanoma Bladder cancer Gastric cancer		Degradation of the extracellular matrix Integrin cell surface interactions Apoptotic cleavage of cell adhesion proteins Adherens junctions interactions RHO GTPases activate IQGAPs InlA-mediated entry of Listeria monocytogenes into host cells

Show/Hide Causal Diseases (5)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Blepharocheilodontic Syndrome	blepharocheilodontic syndrome 1	rs886039685, rs1555515925, rs1555515445	N/A
Breast Cancer	Malignant tumor of breast	rs1131690820, rs878854697, rs121964878, rs786202033, rs864622655	N/A
Cleft Lip With Or Without Cleft Palate	cleft lip with or without cleft palate	rs759207947, rs1367108095, rs1961434061	N/A
gastric cancer	Gastric cancer	rs746481984, rs121964873, rs1567516230, rs587780784, rs587781276	N/A
neoplasm	Neoplasm	rs1961431691	N/A

Show/Hide Unknown Diseases (10)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anophthalmia/Microphthalmia-Esophageal Atresia Syndrome	Anophthalmia-microphthalmia syndrome	N/A	N/A	ClinVar
Breast Carcinoma	hereditary breast carcinoma, breast carcinoma	N/A	N/A	GenCC, ClinVar
Cleft Soft Palate	cleft soft palate	N/A	N/A	GenCC
colon cancer	Colon cancer	N/A	N/A	ClinVar
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Endometrial carcinoma	endometrial carcinoma	N/A	N/A	ClinVar
hereditary cancer	Hereditary cancer	N/A	N/A	ClinVar
Orofacial Cleft	orofacial cleft, orofacial cleft 3	N/A	N/A	ClinVar, GenCC
ovarian cancer	Ovarian cancer	N/A	N/A	ClinVar
Ovarian cancer	familial ovarian cancer	N/A	N/A	GenCC

Show/Hide Text Mining Associations (533)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Inhibit	27793380, 30806528
Abortion Spontaneous	Stimulate	26272359
Acantholysis	Associate	30484070
Accidental Injuries	Associate	16367920
Acromegaly	Associate	30843342, 39201352
Acute Lung Injury	Associate	29402133
Adenocarcinoma	Associate	10408414, 10789716, 11027430, 12194995, 12393869, 12439911, 15452164, 16948518, 18286686, 19653727, 20922573, 21574102, 23121893, 25004291, 25120788 View all (9 more)
Adenocarcinoma	Inhibit	11304579, 22583970, 34706517, 36928883, 8353041, 9422531
Adenocarcinoma	Stimulate	26881627
Adenocarcinoma Follicular	Associate	16224162, 25329121, 26097548, 32093341
Adenocarcinoma Mucinous	Associate	12439911, 19448592, 24696260, 25619476, 34103667, 37925055
Adenocarcinoma Mucinous	Inhibit	20550696
Adenocarcinoma of Lung	Associate	1333788, 23656788, 24318287, 26045824, 28077118, 29311567, 29377583, 29658609, 30008585, 31103348, 31698633, 33411689, 34118147, 35242247, 37340370, 38182570, 7819034 View all (2 more)
Adenocarcinoma of Lung	Stimulate	29116025
Adenoma	Associate	11889072, 20876524, 23029563, 23324246, 23825587, 24875374, 36087100, 9176391
Adenoma	Inhibit	20046424, 25437056
Adenoma Liver Cell	Associate	19465902, 36010583
Adenoma Pleomorphic	Associate	23510689
Adenomatous Polyposis Coli	Associate	11889072, 23504555, 33057364
Adenomatous Polyps	Associate	11889072
Adenomyoepithelioma	Associate	29739933
Adenomyosis	Associate	26307032, 37019419, 39595532
Aicardi Syndrome	Associate	31452946
Allan Herndon Dudley syndrome	Inhibit	35478157
Allergic Fungal Sinusitis	Inhibit	33000196
Alzheimer Disease	Associate	26621834
Ameloblastoma	Associate	23303021, 28390135, 29850393, 32985799
Ameloblastoma	Inhibit	25690860
Amyloidosis	Associate	27069257
Androgen Insensitivity Syndrome	Associate	29365031
Anodontia	Associate	18683894
Anophthalmia with pulmonary hypoplasia	Associate	29952716
Antiphospholipid Syndrome	Stimulate	11937138
Arthritis Psoriatic	Associate	17076892
Arthritis Rheumatoid	Associate	33145365, 35904110
Asthma	Associate	17548604
Astrocytoma	Associate	15367334, 18551395
Ataxia Telangiectasia	Associate	35782055
Atherosclerosis	Associate	18703780, 34329656
Atresia of small intestine	Associate	11788563
Atypical Squamous Cells of the Cervix	Associate	35327954
Barrett Esophagus	Associate	17405999, 22583970, 23382633, 7819034
Barrett Esophagus	Inhibit	9422531
Basal cell carcinoma infundibulocystic	Inhibit	7961105
Behcet Syndrome	Associate	24204729
Beta ketothiolase deficiency	Stimulate	25329121
Beta ketothiolase deficiency	Inhibit	35478157
beta Thalassemia	Associate	38243303
Bile Duct Neoplasms	Inhibit	19420730
Biliary Atresia	Associate	30906331
Biliary Tract Neoplasms	Associate	12107841, 15471559, 19184677, 27941621
Birt Hogg Dube Syndrome	Associate	34031471
Blepharo cheilo dontic syndrome	Associate	28301459, 39596675
Blister	Inhibit	18200054
Bone Diseases	Associate	35646332
Bone Marrow Diseases	Associate	35646332
Brain Neoplasms	Associate	17905526, 18720359, 21196339, 29287594, 36435874
Brain Neoplasms	Inhibit	24933634
Breast Carcinoma In Situ	Associate	11322170, 15696125, 20586632, 23837653, 24023670, 24366306, 26643573, 28095868, 30185420, 31932682, 9365159
Breast Carcinoma In Situ	Inhibit	24966968
Breast Neoplasms	Associate	10433926, 10584868, 11305955, 11322170, 11705887, 11976333, 12163387, 12439718, 14580257, 15161659, 15235021, 15330167, 15459769, 15742334, 16025112 View all (271 more)
Breast Neoplasms	Inhibit	10545506, 10644736, 12068329, 15958594, 19893985, 20551954, 20818341, 22012049, 23890049, 25124632, 26150337, 29133484, 30180878, 31880901, 37369698, 40049332, 8256859 View all (2 more)
Breast Neoplasms	Stimulate	26534844, 36315446
Bronchiolitis Obliterans Syndrome	Associate	19893038
Bronchopulmonary Dysplasia	Associate	9811344
Calcinosis Cutis	Inhibit	10644736, 12888830, 23188432
Calcinosis Cutis	Associate	17607380, 18223552, 19634113, 21240516, 21639893, 21964676, 21975680, 23399642, 27852262, 27919967, 36757813, 8623909
Cap Myopathy	Associate	23475579
Carcinogenesis	Associate	12631658, 12695555, 14675348, 15375433, 16428266, 16512896, 16521229, 17047049, 17663505, 18223216, 18703780, 19940363, 20032387, 20520968, 20715154 View all (36 more)
Carcinoid Tumor	Associate	15712207, 22825745, 25413006, 29422640
Carcinoma	Inhibit	11304579, 17060462, 25315069
Carcinoma	Associate	16982802, 19050793, 25779657, 26125777, 26429873, 26837418, 2774055, 28069049, 28534983, 32487254, 32661742, 9045944
Carcinoma Adenoid Cystic	Associate	15044918, 17520682, 26349748, 28545522, 31452946
Carcinoma Adenosquamous	Inhibit	19270646
Carcinoma Adenosquamous	Associate	23838140
Carcinoma Basal Cell	Associate	26429176, 27058893, 30089731, 36961748, 8286199
Carcinoma Basal Cell	Inhibit	7640213
Carcinoma Ductal	Associate	11305955, 11322170, 12712492, 14580257, 16512896, 17437014, 19751508, 19893985, 22012049, 23188432, 23729783, 25124632, 25645984, 26916073, 28901319, 30760857, 32599083, 39256827 View all (3 more)
Carcinoma Ductal	Inhibit	7534041, 8256859, 8883410
Carcinoma Ductal Breast	Associate	17244359, 19242056, 19789364, 23188432, 30359996, 8183909
Carcinoma Ductal Breast	Inhibit	22012049, 30760857, 8256859
Carcinoma Endometrioid	Inhibit	16461565, 23743934
Carcinoma Endometrioid	Associate	18607832, 19215686, 28174789, 28937296, 29237910
Carcinoma Hepatocellular	Associate	12937151, 14507645, 15831995, 16474379, 16534869, 17000670, 18691339, 18837082, 19140237, 19818350, 20044617, 20331628, 21060828, 21323792, 21345006 View all (80 more)
Carcinoma Hepatocellular	Inhibit	19465902, 30453302
Carcinoma Hepatocellular	Stimulate	24386414
Carcinoma in Situ	Associate	11322170, 15871722, 16033070, 17649807, 23724131, 23837653, 27461702, 27837621
Carcinoma in Situ	Inhibit	12216092, 15685613, 16505783
Carcinoma Intraductal Noninfiltrating	Associate	10897329, 11322170, 14645693, 17244359, 18769130, 21375733, 23062488, 24966968, 27247112, 29344954, 35587107
Carcinoma Large Cell	Associate	15712207
Carcinoma Lobular	Inhibit	12712492, 16512896, 22864775, 30228172, 40645971, 8256859, 9422525
Carcinoma Lobular	Associate	15161659, 15354217, 15696125, 17239264, 26451490, 26643573, 26729235, 27078887, 27811364, 30414230, 31018945, 32599083, 32661241, 35922548, 36332363 View all (7 more)
Carcinoma Lobular	Stimulate	23782331
Carcinoma Merkel Cell	Associate	10923074, 19396152, 22814318
Carcinoma Mucoepidermoid	Associate	15999364
Carcinoma Neuroendocrine	Associate	19396152
Carcinoma Non Small Cell Lung	Associate	11068984, 12771988, 15042681, 15785747, 16598757, 17960794, 18286531, 18303430, 18349282, 18720359, 19150934, 20234816, 20460685, 21170350, 22799366 View all (51 more)
Carcinoma Non Small Cell Lung	Inhibit	19842844, 23621211, 28508744, 29118814
Carcinoma Ovarian Epithelial	Associate	16461565, 17653889, 22543706, 23605324, 24499657, 25230372, 26191276, 26757261, 26887977, 27044634, 29996940, 30324802, 30846486, 31158220, 31653136, 36814597 View all (1 more)
Carcinoma Pancreatic Ductal	Associate	20160041, 21552209, 21992816, 24048788, 25799022, 28475017, 29273724, 29374219, 31177911, 33762591, 35455997, 37246239, 39682758
Carcinoma Pancreatic Ductal	Inhibit	20529828, 29924959
Carcinoma Papillary	Associate	12204061, 14657952, 16224162, 26429174
Carcinoma Papillary	Inhibit	27025787
Carcinoma Papillary Follicular	Associate	26097548
Carcinoma Renal Cell	Associate	11551917, 14657952, 15685621, 17607380, 18195710, 18327819, 19551141, 20074327, 20514858, 21808237, 22363672, 23658743, 26152359, 27619681, 28223537 View all (16 more)
Carcinoma Renal Cell	Inhibit	17060462, 19215686, 30816490, 34825321
Carcinoma Signet Ring Cell	Inhibit	11304579, 18223216
Carcinoma Signet Ring Cell	Associate	11850584, 15138207, 15753528, 16948518, 19050793, 22118538, 26443527, 27509205, 27608893, 28688938, 29131691, 32338015, 32727394, 32997132, 33206267 View all (8 more)
Carcinoma Small Cell	Associate	25413006, 39682758
Carcinoma Squamous Cell	Associate	11900566, 15466396, 16199889, 18264727, 18671846, 20498638, 21507233, 21986963, 22207358, 22692503, 23826417, 23999979, 24758269, 25380749, 25695541 View all (17 more)
Carcinoma Squamous Cell	Inhibit	17071808, 19270647, 21849853, 22850983, 29470526, 34666560, 36308176
Carcinoma Transitional Cell	Associate	16799706, 19849847, 22903481
Carcinoma Verrucous	Associate	20614262
Carcinosarcoma	Associate	19389926
Cataract	Inhibit	28442786, 33274006
Cell Transformation Neoplastic	Associate	12393869, 28851898
Central Nervous System Diseases	Associate	28854563
Chemical and Drug Induced Liver Injury	Inhibit	27881141
Cholangiocarcinoma	Associate	12213730, 15467712, 16311342, 17550320, 18691339, 22068819, 22664794, 23688168, 24272200, 24816558, 24867095, 25077440, 25391422, 30248044, 32020235, 35022330, 38212892 View all (2 more)
Cholangiocarcinoma	Inhibit	18595142, 23480772
Cholestasis Extrahepatic	Associate	19420730
Chondrosarcoma	Associate	26888362
Chordoma	Associate	11729215, 26888362, 29360338
Choriocarcinoma	Inhibit	14675328
Choriocarcinoma	Associate	15507671
Chromosome 22 monosome mosaic	Associate	14970867
Chronic Periodontitis	Associate	21047437
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	35647835
Clear cell metastatic renal cell carcinoma	Associate	15608393, 36347549
Cleft Lip	Associate	15831593, 18683894, 24793288, 24838934, 32260281, 32886433
Cleft Palate	Associate	12068329, 15831593, 24838934, 28151848, 28376813, 31419083, 39596675
Cleft Palate	Stimulate	36468602
Colitis	Associate	10694944
Colitis	Inhibit	24531714
Colitis Associated Neoplasms	Associate	11171827
Colitis Ulcerative	Associate	19915572, 21830274, 25303049, 32775420
Colonic Neoplasms	Associate	11451996, 11470825, 17557293, 19253033, 19302290, 21625458, 23121893, 24284071, 25908636, 26619103, 31658326, 33770698, 36318684, 37189027
Colonic Neoplasms	Inhibit	27513421
Colonic Polyps	Associate	9176391
Colorectal Neoplasms	Inhibit	10362114, 12610504, 18503162, 20571967, 23029563, 25738332, 28759954
Colorectal Neoplasms	Associate	10601549, 10638989, 10694944, 10817509, 10896919, 11035789, 11171827, 11850584, 12824891, 12854171, 15122305, 15154912, 15570051, 15802015, 16369045 View all (143 more)
Colorectal Neoplasms	Stimulate	27488539
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	10694944, 24415879, 31207149
Congenital disorder of glycosylation type 1B	Inhibit	24318287
Coronary Artery Disease	Associate	36538237
Coxa Magna	Associate	35035862
Craniopharyngioma	Associate	28487953
Crohn Disease	Associate	22152681, 30206406, 32775420, 8774128
Crohn Disease	Inhibit	7745114
Cystadenoma	Associate	23605324
Cystic Fibrosis	Associate	1375758
Cystitis Interstitial	Associate	18082196
Cysts	Associate	18587325, 26684027
Darier Disease	Associate	22277942
Death	Associate	18026186, 20922573, 22942707, 27852262, 28954486, 30324802, 33941229, 9176385
Death	Inhibit	19915524
Dentigerous Cyst	Associate	25690860
Depressive Disorder	Associate	18256147
Dermatitis Atopic	Associate	34678092
Diabetes Mellitus	Associate	27411924, 27643646, 29273724
Diabetes Mellitus	Inhibit	37246239
Diabetic Nephropathies	Associate	22629296, 34737094
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	19050793, 25518919, 32102518, 36308176, 39849873
Disease	Inhibit	11533074
Disease	Associate	14708624, 28088268
Drug Related Side Effects and Adverse Reactions	Associate	19531543, 25733818, 35418483
Dwarfism Pituitary	Associate	26391562, 30843342
Eczema	Inhibit	11676834, 18200054
Edema	Associate	20574529, 26683836
Emphysema	Associate	25306249
Endocrine System Diseases	Associate	36332363
Endometrial Hyperplasia	Associate	25282623
Endometrial Neoplasms	Associate	11027430, 11966474, 12497652, 12569599, 15361208, 15736420, 16803534, 18607832, 19215686, 19900189, 21851624, 22569286, 23114646, 23743934, 25282623 View all (15 more)
Endometrial Neoplasms	Inhibit	19604315, 26367784, 28272224, 31233772
Endometriosis	Inhibit	11966474, 29860279, 33218351, 34794738, 9033262
Endometriosis	Associate	22344732, 23899551, 25150394, 26198055, 26484421, 28303918, 29630856, 30702562, 31233772, 32439908, 33249961, 33817715, 35303800, 36233009, 37047609, 37371583, 37867352, 8293849, 9022601 View all (4 more)
Endometritis	Associate	33826645
Enterocolitis Necrotizing	Associate	36371157
Eosinophilic Esophagitis	Inhibit	28712126, 35239721
Eosinophilic Esophagitis	Associate	30211842
Epilepsies Partial	Stimulate	25409297
Epilepsy	Associate	31318984
Epstein Barr Virus Infections	Inhibit	17192051, 23047626
Epstein Barr Virus Infections	Associate	26032781
Esophageal Neoplasms	Associate	17348438, 19222093, 19448414, 20412959, 22069487, 25400779, 26898709, 27513557, 27600761, 27832663, 31186031, 32035486, 32432570, 32925786, 33742771, 36475339 View all (1 more)
Esophageal Squamous Cell Carcinoma	Inhibit	12532436, 17047049, 29866946, 32925786
Esophageal Squamous Cell Carcinoma	Associate	15484291, 17255337, 17273727, 18084253, 18219111, 19222093, 19432901, 19448414, 19448425, 20025748, 20193117, 21148309, 21150312, 25375090, 26617724 View all (12 more)
Esophageal Stenosis	Associate	21333186
Esophagitis	Associate	22069487
Esthesioneuroblastoma Olfactory	Associate	29324814
Euthyroid Sick Syndromes	Associate	29216196
Extranodal Extension	Associate	38358184
Familial cylindromatosis	Stimulate	22832488
Feeding and Eating Disorders	Associate	30989488
Fetal Growth Retardation	Associate	37610607
Fever	Inhibit	23002349
Fever	Associate	34162953
Fibrolamellar hepatocellular carcinoma	Associate	18264082, 21060828
Fibrosis	Associate	19004823, 27478076, 30906331, 31311600
Fibrosis	Inhibit	19465902
Fibrous Dysplasia of Bone	Associate	35454175
Flatfoot	Associate	35197508
Gallbladder Neoplasms	Associate	16309224, 18158568, 25004291
Gallbladder Neoplasms	Inhibit	36656209
Gastritis	Associate	14507661, 16428266, 20520968
Gastritis	Stimulate	24528029
Gastritis Atrophic	Associate	24204729
Gastritis Atrophic	Stimulate	24528029
Gastrointestinal Neoplasms	Associate	10896919, 35705314
Genetic Diseases Inborn	Associate	22595728
Gestational Trophoblastic Disease	Associate	14675328
Glioblastoma	Associate	23482671, 25359730, 33059753, 33763472, 36453704
Glioma	Associate	27589728, 28349823, 29039584, 30015885, 31906574, 32365279, 32521911, 34104086, 34520391, 37818686
Gliosarcoma	Associate	30451796
Glutamate Monosodium Sensitivity	Associate	24660577
Glycogen Storage Disease	Associate	36613675
Glycogen Storage Disease Type IV	Inhibit	25890609
Glycosuria Renal	Associate	26152359
Granular Cell Tumor	Associate	28057062
Granuloma	Associate	23719484
Granuloma Foreign Body	Associate	23719484
Granulosa Cell Tumor	Associate	14970867
Graves Ophthalmopathy	Associate	35846879
Growth Hormone Secreting Pituitary Adenoma	Associate	23825587, 38027102
Hashimoto Disease	Stimulate	35871446
Haspeslagh Fryns Muelenaere syndrome	Associate	20596253
Head and Neck Neoplasms	Associate	15666322, 19192641, 20443891, 21764905, 21939503, 34768995
Heart Failure	Associate	34868339
Helicobacter Infections	Associate	12631658, 16127748, 16428266, 18768510, 20520968, 22827846, 35877235
Helicobacter Infections	Stimulate	22415887, 24528029, 35418175
Helicobacter Infections	Inhibit	9708215
Hematologic Neoplasms	Associate	10807790
Hepatitis B	Associate	23771069, 39207047
Hepatitis C	Associate	27298373
Hepatoblastoma	Inhibit	25695679
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19256762, 21356067, 21764905, 23620408, 24023670, 24127122, 24549055, 29700408, 30623411, 32541686, 36307613, 37563628, 39684258, 9365159
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	27956696
Hereditary pancreatitis	Associate	28376813
Hydatidiform Mole	Inhibit	14675328
Hydatidiform Mole	Associate	15228429, 15507671, 26683836
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	34064969
Hyperostosis corticalis deformans juvenilis	Associate	18469796
Hyperplasia	Associate	20614262
Hypertension	Inhibit	39595551
Hypertension Pulmonary	Associate	31248429
Hypoxia	Inhibit	14507651, 16740659, 17060462, 20010940, 20026874, 21680037, 23002349, 23050024, 24112779, 25096400, 25501705, 27044634, 28764685, 28991229, 30111297, 30556863, 30739528, 36243933 View all (3 more)
Hypoxia	Associate	21499308, 23322209, 25860915, 28794399, 29769799, 34624938
Hypoxia	Stimulate	34162953, 35603730
Hypoxia Brain	Associate	21887310
Hypoxia Brain	Inhibit	23185433, 26379394, 27966740
Idiopathic Pulmonary Fibrosis	Associate	22295148, 32843095, 32899090, 37798725
Idiopathic Pulmonary Fibrosis	Inhibit	35594338
Idiopathic subglottic tracheal stenosis	Associate	37565709
Immunologic Deficiency Syndromes	Associate	18385519
Infections	Inhibit	12857907, 24498111, 36157109, 37285354, 9708215
Infections	Stimulate	15955097
Infections	Associate	27298373, 33066747
Infertility	Associate	25150394
Inflammation	Associate	10700430, 11408275, 16309224, 21830274, 22152681, 22827846, 22828609, 23719484, 27417573, 33945245, 36538237
Inflammation	Inhibit	22969242, 7768969
Inflammatory Bowel Diseases	Associate	10700430, 11408275, 32775420
Inflammatory Breast Neoplasms	Associate	15039594, 16932944, 20503407, 22694825, 23468988, 26207636, 29930294, 30086764, 35927653, 36592055
Intestinal Diseases	Associate	12631658, 15274329
Intestinal Diseases	Inhibit	16080494
Intracranial Embolism	Inhibit	25282623
Irritable Bowel Syndrome	Associate	21752155
Keratosis Actinic	Associate	31299087
Kidney Diseases	Associate	22912891
Kidney Diseases	Inhibit	24040439
Kidney Failure Chronic	Stimulate	38382928
Kidney Neoplasms	Associate	17645803, 28742884, 33846795
Kimura Disease	Associate	27023391, 9176391
Klatskin Tumor	Associate	20594328
Kleefstra Syndrome	Associate	39343771
Laryngeal Neoplasms	Associate	21789704, 23975368, 24470282, 27689323, 27888826, 33336738, 38477084
Laryngitis	Associate	24175817
Laryngopharyngeal Reflux	Associate	31652949
Leiomyosarcoma	Associate	20651304
Leishmaniasis	Associate	38376276
Leukemia	Associate	10807790, 11175634, 15015578, 21102413, 24443786, 27374082, 9744888
Leukemia B Cell	Associate	21459793
Leukemia Lymphocytic Chronic B Cell	Inhibit	10807790
Leukemia Lymphocytic Chronic B Cell	Associate	19745069, 23432814
Leukemia Myeloid	Associate	16766511
Leukemia Myeloid Acute	Inhibit	10807790
Leukemia Myeloid Acute	Associate	23508577, 24164743, 27374082, 35747989
Leukemia Promyelocytic Acute	Associate	12899712, 27374082
Leukoplakia	Associate	28273205
Leukoplakia Oral	Associate	16505783, 25518919, 32102518
Light Fixation Seizure Syndrome	Associate	21264259
Linitis Plastica	Associate	36450891
Lip Diseases	Associate	15831593
Liver Cirrhosis	Inhibit	16474379
Liver Cirrhosis	Associate	39207047
Lung Diseases	Associate	19293150, 25413006, 34727382
Lung Diseases	Inhibit	32396269, 35418483
Lung Diseases Interstitial	Associate	33298584
Lung Neoplasms	Associate	11068984, 11278651, 12937339, 14739904, 17409930, 17960794, 19056535, 19154401, 19177200, 19270647, 22752005, 22818553, 22933707, 23237220, 23244126 View all (29 more)
Lung Neoplasms	Inhibit	24933634, 25163517, 28487957
Lymphatic Diseases	Associate	33761659
Lymphatic Metastasis	Inhibit	10424737, 12532436, 15918205, 17273727, 19048396, 19056535, 20025748, 20551954, 21574102, 21603980, 21639893, 22388757, 22692503, 23251464, 24816558 View all (10 more)
Lymphatic Metastasis	Associate	10604738, 11068984, 12151719, 12460468, 12497652, 12532469, 12771988, 12888830, 15712207, 16237750, 17380028, 18327819, 18395897, 18473353, 18751390 View all (53 more)
Lymphatic Metastasis	Stimulate	12712492, 17649807
Lymphedema	Associate	24373500
Lymphoma	Associate	25226156
Lymphoma B Cell Marginal Zone	Associate	21459793
Lymphoma Large B Cell Diffuse	Associate	21459793, 40459191
Lymphoma Mantle Cell	Associate	16224162
Lymphoma Non Hodgkin	Associate	10551330, 23382633
Lymphoma Non Hodgkin	Inhibit	22119833, 29216196
Magnesium Deficiency	Inhibit	33210606
Marfan Syndrome	Associate	32961817
MASS syndrome	Associate	35646332
Medulloblastoma	Associate	15029256, 15508347, 18551395, 18664619
Melanoma	Associate	10621837, 10793063, 11323412, 11900566, 12435856, 14984058, 15133476, 15610525, 15751018, 15855653, 17235241, 17611626, 19293150, 20098411, 20856146 View all (23 more)
Melanoma	Inhibit	12189238, 33744299, 34769150
Meningeal Carcinomatosis	Associate	1333788
Meningeal Carcinomatosis	Inhibit	30451796
Meningeal Neoplasms	Associate	23029385
Meningioma	Associate	17905526, 19703993, 20574529, 23029385, 26825133, 37925427
Meningioma	Stimulate	25333347
Meningioma	Inhibit	31322546
Mesothelioma	Associate	11900566, 12194995, 15608393
Mesothelioma Malignant	Associate	21305058, 26689197, 27705913, 30111297, 34638565
Metabolic Diseases	Associate	33260674
Metaplasia	Associate	18385519, 23382633
Microcephaly	Associate	31318984
Microphthalmia Isolated 1	Associate	16801346
Mohr Tranebjaerg syndrome	Inhibit	33390772
Monoclonal Gammopathy of Undetermined Significance	Associate	15197802, 17213358
Mouth Diseases	Associate	11966474, 25386850, 26484421, 34706517
Mouth Diseases	Inhibit	16760327
Mouth Neoplasms	Associate	21639893, 22252571, 23250779, 23840677, 23936352, 28393810, 29037125, 32102518, 32495878, 32568177, 32928102, 34534039, 36849997, 39849873
Mucositis	Associate	8774128
Multiple Myeloma	Associate	15197802, 15274395, 17213358, 35646332
Muscle Neoplasms	Inhibit	7768969
Muscular Disorders Atrophic	Associate	29042646
Myelodysplastic Syndromes	Associate	18316853, 26025663
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	24378265
Myositis Inclusion Body	Stimulate	35064929
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	31464093
Myotonic Dystrophy	Associate	29273724
Nasal Polyps	Associate	27393708, 29746583, 31839751, 32047813, 34953475, 37382248
Nasal Polyps	Stimulate	28804222
Nasopharyngeal Carcinoma	Associate	17192051, 17201146, 18751390, 21240516, 24586173, 24935589, 26097576, 28198387, 29693120, 30338802, 31512056, 31557058, 32964976, 33965547, 34080661 View all (4 more)
Nasopharyngeal Carcinoma	Inhibit	27108809
Nasopharyngitis	Associate	21240516
Neoplasm Invasiveness	Associate	11322170, 12532436, 12569599, 15696125, 17649807, 18321996, 25077440, 35295009, 7768969, 7887451, 9223755
Neoplasm Invasiveness	Inhibit	22012049, 35877198, 9155672
Neoplasm Metastasis	Inhibit	10807790, 12414534, 12439718, 15361208, 15778693, 15958594, 18837082, 19182791, 20025748, 20412959, 21114921, 21148309, 22828609, 23483955, 25653486 View all (6 more)
Neoplasm Metastasis	Associate	11526241, 11756660, 11900224, 12357319, 12359056, 12497652, 12631658, 12937339, 14580257, 15026811, 15459769, 15685621, 15800994, 16474379, 16865770 View all (132 more)
Neoplasm Micrometastasis	Associate	15918205
Neoplasms	Associate	10070329, 10206308, 10393933, 10424737, 10433926, 10551330, 10584868, 10601549, 10694944, 10896919, 11027430, 11171827, 11206273, 11304579, 11305955 View all (541 more)
Neoplasms	Inhibit	10362114, 10408856, 10807790, 11068984, 11381089, 11549575, 11900224, 12163387, 12460468, 12532436, 12618882, 12907143, 12937339, 14970867, 14984058 View all (140 more)
Neoplasms	Stimulate	26133168, 28380418, 31505062, 36131343
Neoplasms Adipose Tissue	Inhibit	37369698
Neoplasms Cystic Mucinous and Serous	Associate	16461565, 23122366, 26191276
Neoplasms Ductal Lobular and Medullary	Associate	29344954
Neoplasms Fibroepithelial	Inhibit	29216196
Neoplasms Glandular and Epithelial	Associate	12810698, 15888043, 17437014, 17645803
Neoplasms Glandular and Epithelial	Inhibit	18385519
Neoplasms Neuroepithelial	Associate	18551395
Neoplasms Squamous Cell	Associate	14708624, 17047049, 22341307, 34081040
Neoplastic Cells Circulating	Associate	35241536
Neoplastic Syndromes Hereditary	Associate	24373500, 30068367, 32886433, 33827469, 36916756
Nephrolithiasis	Associate	24023817
Neurilemmoma	Stimulate	25333347
Neuroblastoma	Associate	22580460, 28393230, 35531888
Neuroendocrine Tumors	Associate	15712207, 27784972, 33789624, 39682758
Neurofibrosarcoma	Associate	11900566
Neurotoxicity Syndromes	Associate	34831151
Niemann Pick Disease Type C	Associate	24367666, 29854578
NOG Related Symphalangism Spectrum Disorder	Inhibit	12799639
Non alcoholic Fatty Liver Disease	Associate	31311600
Non Muscle Invasive Bladder Neoplasms	Associate	22253920, 37119243
O'Donnell Pappas syndrome	Associate	21179238
Oculocutaneous albinism type 2	Associate	22888908
Odontogenic Tumors	Inhibit	25690860, 25879017
Odontoma	Associate	28390135
Oncogene Addiction	Inhibit	33068045
Oral Submucous Fibrosis	Associate	23250779, 37147960
Orofacial Cleft 1	Associate	24838934, 28151848, 28301459, 28550290, 32260281, 32710482, 39596675
Oropharyngeal Neoplasms	Associate	21958417
Osteoporosis	Stimulate	37203779
Osteosarcoma	Associate	22006429, 24714960, 25339006, 27155790, 27532429, 28338204, 28388584, 29048621, 33401246, 38538251
Otorhinolaryngologic Diseases	Associate	29237910
Ovarian Cysts	Associate	26684027, 28623900
Ovarian Diseases	Associate	14970867, 25150394, 26684027, 33218351
Ovarian Neoplasms	Associate	14507651, 14520463, 15367415, 18026186, 18559505, 19028702, 19048126, 19486012, 20583256, 20610539, 20797318, 21264259, 21996746, 22479527, 22543706 View all (44 more)
Ovarian Neoplasms	Inhibit	29952249, 30653577, 32547317
Pancreatic Neoplasms	Associate	11401320, 12532469, 17354228, 18223216, 19302290, 19584296, 19608876, 20579395, 20589377, 21552209, 21909380, 22041584, 22064652, 22458379, 22901124 View all (27 more)
Pancreatic Neoplasms	Inhibit	12434297, 17334348, 23674382, 40315568
Pancreatitis Chronic	Inhibit	26183380
Papillomavirus Infections	Associate	25035383, 25367268
Paraproteinemias	Associate	15197802
Parathyroid Diseases	Associate	34706517
Parathyroid Neoplasms	Associate	40362680
Parkinson Disease	Associate	33791366
Paroxysmal nonkinesigenic dyskinesia	Associate	28875602
Pemphigoid Benign Mucous Membrane	Associate	21781454
Pemphigoid Bullous	Associate	21781454
Pemphigus	Associate	36212929
Penile Induration	Associate	24294365, 36757813
Periodontal Diseases	Associate	20930352
Periodontitis	Associate	21047437
Peritoneal Neoplasms	Associate	31171626
Peritonitis	Associate	12890743, 21518759, 26757261, 31570735
Personality Disorders	Associate	15459769, 16244541, 25178329, 28934230, 29295717
Personality Disorders	Inhibit	28766847
Phenylketonurias	Associate	33260674
Pheochromocytoma	Associate	15796198
Pituitary Neoplasms	Associate	17873891, 26617803, 33203795
Placenta Accreta	Inhibit	31322233
Pleural Diseases	Associate	27735037
Pleural Effusion	Associate	26045824, 26919626
Pleural Effusion Malignant	Associate	18055295
Pneumonia	Associate	26443527
Polycystic Kidney Autosomal Dominant	Associate	10747091, 14718571, 19259356, 28385574
Polycystic Kidney Autosomal Recessive	Associate	30414501
Polycythemia Vera	Associate	36436516, 37239438
Polyps	Associate	11889072, 12117880, 20876524, 9176391
Poroma	Inhibit	16512896
Posterior Capsular Rupture Ocular	Associate	28764685
Precancerous Conditions	Associate	18246045
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	27036041, 35747989
Prodromal Symptoms	Associate	19748854
Progesterone Resistance	Associate	30691046
Prostatic Hyperplasia	Associate	31212363, 33031138
Prostatic Neoplasms	Associate	10206308, 11792709, 12393869, 14511406, 15870707, 15958559, 15958594, 17979146, 18084254, 18618693, 20672324, 21281819, 21546539, 21694441, 21756376 View all (46 more)
Prostatic Neoplasms	Inhibit	23298185, 24896103
Prostatitis	Associate	11801604, 12095980, 12393869, 21764905, 32282726
Prostatitis	Inhibit	12810698, 27956696
Pseudomyxoma Peritonei	Associate	17031402
Psoriasis	Associate	26617803, 33416099
Psychomotor Disorders	Associate	31318984
Pterygium	Associate	17360734
Pulmonary Disease Chronic Obstructive	Inhibit	24452374, 25745049, 31427443
Pulmonary Disease Chronic Obstructive	Associate	26081431, 29068985, 29581578, 36420658
Pyruvate Carboxylase Deficiency Disease	Inhibit	33237989
Pyruvate Carboxylase Deficiency Disease	Associate	35647835
Q Fever	Associate	31293984, 37285354, 37446087
Radiation Injuries	Inhibit	33785878
Radicular Cyst	Associate	25690860, 33274608
Recombinant chromosome 8 syndrome	Associate	36709040
Rectal Diseases	Associate	30206406
Rectal Neoplasms	Associate	21975680
Renal cell carcinoma 1	Associate	25609022
Renal cell carcinoma 1	Stimulate	27764163
Renal Insufficiency	Associate	27793380
Respiratory Tract Infections	Associate	27129576
Retinal Dysplasia	Associate	16505783, 19448414, 23382633
Retinal Dysplasia	Inhibit	32102518, 36308176, 9422531
Retinoblastoma	Associate	10092652, 33098307
Rhabdoid Tumor	Associate	35794510
Rufous oculocutaneous albinism	Associate	12439911
Salivary Gland Adenoma Pleomorphic	Associate	25611270
Sarcoidosis	Associate	23719484
Sarcoma	Associate	21390241, 30862685
Sarcoma Ewing	Associate	17409416
Sarcoma Myeloid	Associate	35646332
Sarcoma Synovial	Associate	11733362, 11900566, 21809991, 24294365
Seminoma	Associate	27461702, 32615059, 38069214
Sex Cord Gonadal Stromal Tumors	Associate	27097978
Sexual Dysfunction Physiological	Associate	35920182
Sick Sinus Syndrome	Associate	24443268
Sjogren's Syndrome	Associate	16316423, 31165469
Skin Diseases	Associate	33416099
Skin Neoplasms	Associate	35263398
Small Cell Lung Carcinoma	Associate	15712207, 24933634, 26919626, 28212573, 8387530
Spherocytosis Type 1	Associate	37922232
Spinal Cord Injuries	Inhibit	29482913
Spondylarthropathies	Associate	10700430
Squamous Cell Carcinoma of Head and Neck	Associate	12888830, 15666322, 15685613, 16505783, 18473353, 18991282, 19147758, 19243631, 19336864, 19549906, 19915524, 20614262, 21939503, 22072429, 22161744 View all (64 more)
Squamous Cell Carcinoma of Head and Neck	Inhibit	18711702, 21639893, 39849873, 40004538
Squamous Intraepithelial Lesions	Inhibit	10433943, 18264727
Squamous Intraepithelial Lesions	Associate	21103617, 27837621, 29587669
Status Asthmaticus	Associate	17548604
Stomach Diseases	Associate	12439911, 16948518, 18768510, 24528029, 26443527, 26568477, 34251444, 36064550
Stomach Neoplasms	Associate	10206317, 10433926, 10551330, 10604738, 10682667, 10896919, 11194192, 11304579, 11305955, 11419427, 11747475, 11920500, 12151719, 12163364, 12439911 View all (276 more)
Stomach Neoplasms	Inhibit	12414534, 18395897, 25822437, 27412620, 28983895, 30642281, 39206977, 8188525
Stomach Neoplasms	Stimulate	29042646
Supraglottitis	Associate	36149200
Tachycardia Atrioventricular Nodal Reentry	Associate	25124632, 26097606
Tarlov Cysts	Associate	17520682, 23783026, 26349748, 33789624
Tertiary Lymphoid Structures	Associate	11206273, 20529814, 21789704, 23251464, 24696260, 25413006, 28112378, 28759954, 28832071, 32348353, 7819034
Tertiary Lymphoid Structures	Stimulate	23778524, 24443268
Testicular Neoplasms	Associate	16333245
Thoracic Injuries	Associate	30572945
Thoracic Neoplasms	Associate	7819034
Thymoma	Associate	9529983
Thyroid cancer follicular	Inhibit	23264214
Thyroid cancer medullary	Associate	27409604
Thyroid Cancer Papillary	Inhibit	23264214, 23324246
Thyroid Cancer Papillary	Associate	25755746, 26097548, 29655286, 30175973, 30534810, 35871446
Thyroid Carcinoma Anaplastic	Inhibit	25755746
Thyroid Carcinoma Anaplastic	Associate	27796151, 35491899
Thyroid Neoplasms	Associate	16224162, 19589279, 23264214, 25329121, 27273957, 31648166, 32698816, 32737449, 33813463, 33831503, 39179334
Thyroid Neoplasms	Inhibit	24126800
Thyroid Nodule	Associate	22958914, 23324246, 32239101
Thyroiditis	Associate	24126800
Tongue Neoplasms	Associate	11206273, 11900224, 27431199, 36074434
Triple Negative Breast Neoplasms	Associate	19531543, 22126395, 22638807, 23443971, 24390667, 25068292, 25953261, 26039245, 28802099, 29049198, 30338806, 30602372, 30628666, 32244385, 33650675 View all (5 more)
Triple Negative Breast Neoplasms	Inhibit	20551954
Triple Negative Breast Neoplasms	Stimulate	31450894
Tuberculosis Meningeal	Associate	28875602
Turcot syndrome	Associate	26619103, 34473724
Typical Teratoid Rhabdoid Tumor	Associate	15508347
Ulcer	Associate	20191040, 8774128
Ulcer	Inhibit	7745114
Urethral Neoplasms	Associate	12216092, 12799639, 20818341, 21138866, 28002521, 28088268, 30447301, 31263157, 35763651, 7669581
Urinary Bladder Diseases	Associate	16367920
Urinary Bladder Neoplasms	Inhibit	10390008, 11549575, 27058893, 28232500, 29620261, 7745120
Urinary Bladder Neoplasms	Associate	10901372, 11737053, 12357319, 16675571, 17201133, 17404085, 18702824, 18980977, 22253920, 22903481, 23239884, 24325461, 24571540, 24856504, 25826491 View all (23 more)
Urolithiasis	Inhibit	25329457
Urologic Neoplasms	Associate	20421722, 22951176, 31291718
Uterine Cervical Dysplasia	Associate	12773202, 17894941, 23826417, 24998916, 26183380, 27223886, 27837621
Uterine Cervical Neoplasms	Associate	12773202, 16803511, 16928264, 17009983, 17894941, 19690767, 20495745, 22942707, 23322209, 24058594, 24751719, 25007342, 25330011, 25380749, 25988335 View all (16 more)
Uterine Cervical Neoplasms	Inhibit	14675348
Uterine Cervicitis	Associate	26032781, 29587669, 35144405
Uterine Diseases	Associate	25282623, 33249961, 35303800, 37047609
Uterine Neoplasms	Associate	30091462
Uveal melanoma	Associate	35426938
Varicella Zoster Virus Infection	Associate	30835269
Vascular System Injuries	Inhibit	25282623
VATER association	Associate	24516707
Vitiligo	Associate	29024688
von Hippel Lindau Disease	Associate	19551141
Vulvar Neoplasms	Associate	23826417
Waldenstrom Macroglobulinemia	Associate	26901067, 29781067, 30865491, 31638990, 33473164, 40349989
Waldenstrom Macroglobulinemia	Inhibit	31054897, 33237989
Weight Loss	Associate	30989488
Wilms Tumor	Associate	12890743, 31114995, 37904849
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Inhibit	35216384

CDH1 (cadherin 1)