Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	998
Gene name	Cell division cycle 42
Gene symbol	CDC42
Synonyms (NCBI Gene)	CDC42HsG25KTKS
Chromosome	1
Chromosome location	1p36.12
Summary	The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly simila

Show/Hide all (12)

SNP ID	Visualize variation	Clinical significance	Consequence
rs797044870	A>G	Pathogenic	Missense variant, coding sequence variant
rs797044916	A>G	Pathogenic	Missense variant, coding sequence variant
rs864309721	A>G	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1057518022	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1064795845	T>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1553196096	G>A	Pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs1553196100	G>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1553196101	T>C	Pathogenic	Coding sequence variant, missense variant
rs1553196119	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553196134	C>T	Pathogenic	Coding sequence variant, missense variant
rs1553196539	G>A	Pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1570024112	T>C	Likely-pathogenic	Coding sequence variant, missense variant

615

Show/Hide all (615)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000636	hsa-miR-224-5p	Luciferase reporter assayqRT-PCRWestern blot	20023705
MIRT004037	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	21186079
MIRT004037	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	21186079
MIRT005485	hsa-miR-137	Luciferase reporter assayWestern blot	20473940
MIRT005964	hsa-miR-216a-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005964	hsa-miR-216a-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005965	hsa-miR-330-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005965	hsa-miR-330-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005966	hsa-miR-608	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005966	hsa-miR-608	ImmunohistochemistryLuciferase reporter assayWestern blot	21149267
MIRT005485	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	21221794
MIRT005485	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	21221794
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT005485	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	21221794
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006489	hsa-miR-29c-3p	Luciferase reporter assayWestern blot	19079265
MIRT006488	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	19079265
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19079265
MIRT006995	hsa-miR-195-5p	Luciferase reporter assay	22802111
MIRT006995	hsa-miR-195-5p	Luciferase reporter assay	22802111
MIRT005485	hsa-miR-137	Luciferase reporter assay	23178712
MIRT005485	hsa-miR-137	Luciferase reporter assay	23178712
MIRT005965	hsa-miR-330-3p	Luciferase reporter assayqRT-PCRWestern blot	23337504
MIRT005965	hsa-miR-330-3p	Luciferase reporter assayqRT-PCRWestern blot	23337504
MIRT005965	hsa-miR-330-3p	Luciferase reporter assayWestern blot	23337504
MIRT019885	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT005485	hsa-miR-137	Reporter assay;Other	20473940
MIRT023726	hsa-miR-1-3p	Proteomics	18668040
MIRT044369	hsa-miR-106b-5p	CLASH	23622248
MIRT041813	hsa-miR-484	CLASH	23622248
MIRT038837	hsa-miR-93-3p	CLASH	23622248
MIRT000636	hsa-miR-224-5p	qRT-PCR	24817781
MIRT053177	hsa-miR-133b	ImmunoblotLuciferase reporter assayMicroarray	22179829
MIRT006490	hsa-miR-29a-3p	qRT-PCRWestern blot	20507733
MIRT006488	hsa-miR-29b-3p	qRT-PCRWestern blot	20507733
MIRT006489	hsa-miR-29c-3p	qRT-PCRWestern blot	20507733
MIRT000327	hsa-miR-133a-3p	Luciferase reporter assayqRT-PCRWestern blot	25152372
MIRT000327	hsa-miR-133a-3p	Luciferase reporter assayqRT-PCRWestern blot	25152372
MIRT053177	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	25152372
MIRT053177	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	25152372
MIRT054636	hsa-miR-204-5p	ChIP-seqImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24613926
MIRT054636	hsa-miR-204-5p	ChIP-seqImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24613926
0	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	22179829
MIRT005485	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	24465609
MIRT006995	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blot	24025765
MIRT000636	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT000636	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assay	24085298
MIRT000636	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT000636	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT006490	hsa-miR-29a-3p	Luciferase reporter assay	24085298
MIRT704845	hsa-miR-21-3p	HITS-CLIP	23313552
MIRT704844	hsa-miR-3591-3p	HITS-CLIP	23313552
MIRT704843	hsa-miR-3914	HITS-CLIP	23313552
MIRT704842	hsa-miR-1207-3p	HITS-CLIP	23313552
MIRT133821	hsa-miR-20a-3p	HITS-CLIP	23313552
MIRT440971	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT440971	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT736283	hsa-miR-6132	MicroarrayRNA-seq	32075190
MIRT704845	hsa-miR-21-3p	HITS-CLIP	23313552
MIRT704844	hsa-miR-3591-3p	HITS-CLIP	23313552
MIRT704843	hsa-miR-3914	HITS-CLIP	23313552
MIRT704842	hsa-miR-1207-3p	HITS-CLIP	23313552
MIRT133821	hsa-miR-20a-3p	HITS-CLIP	23313552
MIRT755936	hsa-miR-206	Luciferase reporter assayWestern blottingin vitro cullelar assays	38069061
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877638	hsa-miR-1238	CLIP-seq
MIRT877639	hsa-miR-1257	CLIP-seq
MIRT877640	hsa-miR-1265	CLIP-seq
MIRT877641	hsa-miR-1272	CLIP-seq
MIRT877642	hsa-miR-1278	CLIP-seq
MIRT877643	hsa-miR-1322	CLIP-seq
MIRT877644	hsa-miR-25	CLIP-seq
MIRT877645	hsa-miR-2964a-5p	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877647	hsa-miR-29a	CLIP-seq
MIRT877648	hsa-miR-29b	CLIP-seq
MIRT877649	hsa-miR-29c	CLIP-seq
MIRT877650	hsa-miR-3065-5p	CLIP-seq
MIRT877651	hsa-miR-3120-5p	CLIP-seq
MIRT877652	hsa-miR-3140-3p	CLIP-seq
MIRT877653	hsa-miR-3153	CLIP-seq
MIRT877654	hsa-miR-3192	CLIP-seq
MIRT877655	hsa-miR-32	CLIP-seq
MIRT877656	hsa-miR-3202	CLIP-seq
MIRT877657	hsa-miR-3605-5p	CLIP-seq
MIRT877658	hsa-miR-363	CLIP-seq
MIRT877659	hsa-miR-367	CLIP-seq
MIRT877660	hsa-miR-3689a-3p	CLIP-seq
MIRT877661	hsa-miR-3689c	CLIP-seq
MIRT877662	hsa-miR-3692	CLIP-seq
MIRT877663	hsa-miR-371b-5p	CLIP-seq
MIRT877664	hsa-miR-3923	CLIP-seq
MIRT877665	hsa-miR-3925-3p	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT877668	hsa-miR-4270	CLIP-seq
MIRT877669	hsa-miR-4271	CLIP-seq
MIRT877670	hsa-miR-4275	CLIP-seq
MIRT877671	hsa-miR-4426	CLIP-seq
MIRT877672	hsa-miR-4441	CLIP-seq
MIRT877673	hsa-miR-4474-5p	CLIP-seq
MIRT877674	hsa-miR-4528	CLIP-seq
MIRT877675	hsa-miR-4647	CLIP-seq
MIRT877676	hsa-miR-4655-3p	CLIP-seq
MIRT877677	hsa-miR-4662b	CLIP-seq
MIRT877678	hsa-miR-4666-3p	CLIP-seq
MIRT877679	hsa-miR-4668-5p	CLIP-seq
MIRT877680	hsa-miR-4698	CLIP-seq
MIRT877681	hsa-miR-4716-3p	CLIP-seq
MIRT877682	hsa-miR-4725-3p	CLIP-seq
MIRT877683	hsa-miR-4728-5p	CLIP-seq
MIRT877684	hsa-miR-4747-5p	CLIP-seq
MIRT877685	hsa-miR-4764-5p	CLIP-seq
MIRT877686	hsa-miR-4777-3p	CLIP-seq
MIRT877687	hsa-miR-4797-5p	CLIP-seq
MIRT877688	hsa-miR-516b	CLIP-seq
MIRT877689	hsa-miR-518a-5p	CLIP-seq
MIRT877690	hsa-miR-520a-5p	CLIP-seq
MIRT877691	hsa-miR-525-5p	CLIP-seq
MIRT877692	hsa-miR-527	CLIP-seq
MIRT877693	hsa-miR-548ad	CLIP-seq
MIRT877694	hsa-miR-616	CLIP-seq
MIRT877695	hsa-miR-625	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT877697	hsa-miR-654-3p	CLIP-seq
MIRT877698	hsa-miR-759	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877700	hsa-miR-766	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT877702	hsa-miR-92a	CLIP-seq
MIRT877703	hsa-miR-92b	CLIP-seq
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877638	hsa-miR-1238	CLIP-seq
MIRT877704	hsa-miR-1243	CLIP-seq
MIRT877641	hsa-miR-1272	CLIP-seq
MIRT877643	hsa-miR-1322	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT877706	hsa-miR-18a	CLIP-seq
MIRT877707	hsa-miR-18b	CLIP-seq
MIRT877708	hsa-miR-1909	CLIP-seq
MIRT877709	hsa-miR-200b	CLIP-seq
MIRT877710	hsa-miR-200c	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877711	hsa-miR-299-3p	CLIP-seq
MIRT877647	hsa-miR-29a	CLIP-seq
MIRT877648	hsa-miR-29b	CLIP-seq
MIRT877649	hsa-miR-29c	CLIP-seq
MIRT877650	hsa-miR-3065-5p	CLIP-seq
MIRT877651	hsa-miR-3120-5p	CLIP-seq
MIRT877712	hsa-miR-3132	CLIP-seq
MIRT877713	hsa-miR-3148	CLIP-seq
MIRT877714	hsa-miR-342-3p	CLIP-seq
MIRT877715	hsa-miR-361-5p	CLIP-seq
MIRT877716	hsa-miR-3654	CLIP-seq
MIRT877717	hsa-miR-3671	CLIP-seq
MIRT877663	hsa-miR-371b-5p	CLIP-seq
MIRT877665	hsa-miR-3925-3p	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT877668	hsa-miR-4270	CLIP-seq
MIRT877670	hsa-miR-4275	CLIP-seq
MIRT877718	hsa-miR-4276	CLIP-seq
MIRT877719	hsa-miR-4282	CLIP-seq
MIRT877720	hsa-miR-429	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT877672	hsa-miR-4441	CLIP-seq
MIRT877673	hsa-miR-4474-5p	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877676	hsa-miR-4655-3p	CLIP-seq
MIRT877723	hsa-miR-4659a-3p	CLIP-seq
MIRT877724	hsa-miR-4659b-3p	CLIP-seq
MIRT877678	hsa-miR-4666-3p	CLIP-seq
MIRT877679	hsa-miR-4668-5p	CLIP-seq
MIRT877680	hsa-miR-4698	CLIP-seq
MIRT877725	hsa-miR-4729	CLIP-seq
MIRT877726	hsa-miR-4735-3p	CLIP-seq
MIRT877727	hsa-miR-4760-3p	CLIP-seq
MIRT877728	hsa-miR-4761-3p	CLIP-seq
MIRT877687	hsa-miR-4797-5p	CLIP-seq
MIRT877729	hsa-miR-488	CLIP-seq
MIRT877688	hsa-miR-516b	CLIP-seq
MIRT877690	hsa-miR-520a-5p	CLIP-seq
MIRT877730	hsa-miR-520d-5p	CLIP-seq
MIRT877731	hsa-miR-524-5p	CLIP-seq
MIRT877691	hsa-miR-525-5p	CLIP-seq
MIRT877732	hsa-miR-532-5p	CLIP-seq
MIRT877733	hsa-miR-548an	CLIP-seq
MIRT877734	hsa-miR-579	CLIP-seq
MIRT877735	hsa-miR-607	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT877697	hsa-miR-654-3p	CLIP-seq
MIRT877736	hsa-miR-664	CLIP-seq
MIRT877698	hsa-miR-759	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877700	hsa-miR-766	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT1960070	hsa-miR-1	CLIP-seq
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877638	hsa-miR-1238	CLIP-seq
MIRT877641	hsa-miR-1272	CLIP-seq
MIRT1960071	hsa-miR-128	CLIP-seq
MIRT877643	hsa-miR-1322	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT1960072	hsa-miR-2053	CLIP-seq
MIRT755936	hsa-miR-206	CLIP-seq
MIRT1960073	hsa-miR-2117	CLIP-seq
MIRT1960074	hsa-miR-224	CLIP-seq
MIRT1960075	hsa-miR-27a	CLIP-seq
MIRT1960076	hsa-miR-27b	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877647	hsa-miR-29a	CLIP-seq
MIRT877648	hsa-miR-29b	CLIP-seq
MIRT877649	hsa-miR-29c	CLIP-seq
MIRT877650	hsa-miR-3065-5p	CLIP-seq
MIRT1960077	hsa-miR-31	CLIP-seq
MIRT877651	hsa-miR-3120-5p	CLIP-seq
MIRT877652	hsa-miR-3140-3p	CLIP-seq
MIRT1960078	hsa-miR-3146	CLIP-seq
MIRT1960079	hsa-miR-3160-3p	CLIP-seq
MIRT1960080	hsa-miR-3184	CLIP-seq
MIRT1960081	hsa-miR-3660	CLIP-seq
MIRT1960082	hsa-miR-3673	CLIP-seq
MIRT877662	hsa-miR-3692	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT1960083	hsa-miR-423-5p	CLIP-seq
MIRT1960084	hsa-miR-4255	CLIP-seq
MIRT1960085	hsa-miR-4256	CLIP-seq
MIRT1960086	hsa-miR-4273	CLIP-seq
MIRT877670	hsa-miR-4275	CLIP-seq
MIRT1960087	hsa-miR-4286	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT1960088	hsa-miR-4307	CLIP-seq
MIRT1960089	hsa-miR-4312	CLIP-seq
MIRT1960090	hsa-miR-433	CLIP-seq
MIRT877671	hsa-miR-4426	CLIP-seq
MIRT1960091	hsa-miR-4437	CLIP-seq
MIRT1960092	hsa-miR-4470	CLIP-seq
MIRT1960093	hsa-miR-4487	CLIP-seq
MIRT1960094	hsa-miR-4491	CLIP-seq
MIRT1960095	hsa-miR-4526	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877675	hsa-miR-4647	CLIP-seq
MIRT877676	hsa-miR-4655-3p	CLIP-seq
MIRT1960096	hsa-miR-4657	CLIP-seq
MIRT877677	hsa-miR-4662b	CLIP-seq
MIRT877678	hsa-miR-4666-3p	CLIP-seq
MIRT1960097	hsa-miR-4674	CLIP-seq
MIRT1960098	hsa-miR-4688	CLIP-seq
MIRT1960099	hsa-miR-4704-3p	CLIP-seq
MIRT1960100	hsa-miR-4713-5p	CLIP-seq
MIRT1960101	hsa-miR-4762-3p	CLIP-seq
MIRT1960102	hsa-miR-4762-5p	CLIP-seq
MIRT1960103	hsa-miR-4779	CLIP-seq
MIRT877687	hsa-miR-4797-5p	CLIP-seq
MIRT877729	hsa-miR-488	CLIP-seq
MIRT877688	hsa-miR-516b	CLIP-seq
MIRT877732	hsa-miR-532-5p	CLIP-seq
MIRT1960104	hsa-miR-545	CLIP-seq
MIRT1960105	hsa-miR-558	CLIP-seq
MIRT1960106	hsa-miR-583	CLIP-seq
MIRT1960107	hsa-miR-595	CLIP-seq
MIRT1960108	hsa-miR-613	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT877697	hsa-miR-654-3p	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT1960070	hsa-miR-1	CLIP-seq
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877638	hsa-miR-1238	CLIP-seq
MIRT877704	hsa-miR-1243	CLIP-seq
MIRT877639	hsa-miR-1257	CLIP-seq
MIRT877640	hsa-miR-1265	CLIP-seq
MIRT877641	hsa-miR-1272	CLIP-seq
MIRT877642	hsa-miR-1278	CLIP-seq
MIRT1960071	hsa-miR-128	CLIP-seq
MIRT877643	hsa-miR-1322	CLIP-seq
MIRT2196955	hsa-miR-141	CLIP-seq
MIRT2196956	hsa-miR-1827	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT877706	hsa-miR-18a	CLIP-seq
MIRT877707	hsa-miR-18b	CLIP-seq
MIRT877708	hsa-miR-1909	CLIP-seq
MIRT2196957	hsa-miR-200a	CLIP-seq
MIRT755936	hsa-miR-206	CLIP-seq
MIRT2196958	hsa-miR-2110	CLIP-seq
MIRT1960074	hsa-miR-224	CLIP-seq
MIRT877644	hsa-miR-25	CLIP-seq
MIRT1960075	hsa-miR-27a	CLIP-seq
MIRT1960076	hsa-miR-27b	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877711	hsa-miR-299-3p	CLIP-seq
MIRT877647	hsa-miR-29a	CLIP-seq
MIRT877648	hsa-miR-29b	CLIP-seq
MIRT877649	hsa-miR-29c	CLIP-seq
MIRT877650	hsa-miR-3065-5p	CLIP-seq
MIRT1960077	hsa-miR-31	CLIP-seq
MIRT877651	hsa-miR-3120-5p	CLIP-seq
MIRT2196959	hsa-miR-3124-3p	CLIP-seq
MIRT2196960	hsa-miR-3127-3p	CLIP-seq
MIRT877712	hsa-miR-3132	CLIP-seq
MIRT877652	hsa-miR-3140-3p	CLIP-seq
MIRT1960078	hsa-miR-3146	CLIP-seq
MIRT1960079	hsa-miR-3160-3p	CLIP-seq
MIRT2196961	hsa-miR-3179	CLIP-seq
MIRT1960080	hsa-miR-3184	CLIP-seq
MIRT2196962	hsa-miR-3190	CLIP-seq
MIRT877654	hsa-miR-3192	CLIP-seq
MIRT877655	hsa-miR-32	CLIP-seq
MIRT877656	hsa-miR-3202	CLIP-seq
MIRT2196963	hsa-miR-34b	CLIP-seq
MIRT877657	hsa-miR-3605-5p	CLIP-seq
MIRT2196964	hsa-miR-3613-3p	CLIP-seq
MIRT877715	hsa-miR-361-5p	CLIP-seq
MIRT2196965	hsa-miR-3622a-3p	CLIP-seq
MIRT2196966	hsa-miR-3622b-3p	CLIP-seq
MIRT877658	hsa-miR-363	CLIP-seq
MIRT2196967	hsa-miR-3646	CLIP-seq
MIRT2196968	hsa-miR-3653	CLIP-seq
MIRT877716	hsa-miR-3654	CLIP-seq
MIRT2196969	hsa-miR-3658	CLIP-seq
MIRT2196970	hsa-miR-3663-3p	CLIP-seq
MIRT2196971	hsa-miR-3667-3p	CLIP-seq
MIRT877659	hsa-miR-367	CLIP-seq
MIRT877717	hsa-miR-3671	CLIP-seq
MIRT1960082	hsa-miR-3673	CLIP-seq
MIRT877660	hsa-miR-3689a-3p	CLIP-seq
MIRT877661	hsa-miR-3689c	CLIP-seq
MIRT877662	hsa-miR-3692	CLIP-seq
MIRT877663	hsa-miR-371b-5p	CLIP-seq
MIRT877664	hsa-miR-3923	CLIP-seq
MIRT877665	hsa-miR-3925-3p	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT1960083	hsa-miR-423-5p	CLIP-seq
MIRT877668	hsa-miR-4270	CLIP-seq
MIRT877669	hsa-miR-4271	CLIP-seq
MIRT877670	hsa-miR-4275	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT1960088	hsa-miR-4307	CLIP-seq
MIRT1960089	hsa-miR-4312	CLIP-seq
MIRT1960090	hsa-miR-433	CLIP-seq
MIRT877671	hsa-miR-4426	CLIP-seq
MIRT1960091	hsa-miR-4437	CLIP-seq
MIRT877672	hsa-miR-4441	CLIP-seq
MIRT1960092	hsa-miR-4470	CLIP-seq
MIRT877673	hsa-miR-4474-5p	CLIP-seq
MIRT2196972	hsa-miR-4477a	CLIP-seq
MIRT1960093	hsa-miR-4487	CLIP-seq
MIRT1960094	hsa-miR-4491	CLIP-seq
MIRT877674	hsa-miR-4528	CLIP-seq
MIRT2196973	hsa-miR-4639-5p	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877675	hsa-miR-4647	CLIP-seq
MIRT2196974	hsa-miR-4650-5p	CLIP-seq
MIRT877676	hsa-miR-4655-3p	CLIP-seq
MIRT1960096	hsa-miR-4657	CLIP-seq
MIRT877723	hsa-miR-4659a-3p	CLIP-seq
MIRT877724	hsa-miR-4659b-3p	CLIP-seq
MIRT877677	hsa-miR-4662b	CLIP-seq
MIRT1960097	hsa-miR-4674	CLIP-seq
MIRT1960098	hsa-miR-4688	CLIP-seq
MIRT2196975	hsa-miR-4690-5p	CLIP-seq
MIRT877680	hsa-miR-4698	CLIP-seq
MIRT2196976	hsa-miR-4699-3p	CLIP-seq
MIRT1960099	hsa-miR-4704-3p	CLIP-seq
MIRT877681	hsa-miR-4716-3p	CLIP-seq
MIRT877682	hsa-miR-4725-3p	CLIP-seq
MIRT877683	hsa-miR-4728-5p	CLIP-seq
MIRT877725	hsa-miR-4729	CLIP-seq
MIRT877726	hsa-miR-4735-3p	CLIP-seq
MIRT877684	hsa-miR-4747-5p	CLIP-seq
MIRT877727	hsa-miR-4760-3p	CLIP-seq
MIRT877728	hsa-miR-4761-3p	CLIP-seq
MIRT1960102	hsa-miR-4762-5p	CLIP-seq
MIRT877685	hsa-miR-4764-5p	CLIP-seq
MIRT1960103	hsa-miR-4779	CLIP-seq
MIRT877687	hsa-miR-4797-5p	CLIP-seq
MIRT2196977	hsa-miR-4800-3p	CLIP-seq
MIRT877729	hsa-miR-488	CLIP-seq
MIRT877688	hsa-miR-516b	CLIP-seq
MIRT877690	hsa-miR-520a-5p	CLIP-seq
MIRT877691	hsa-miR-525-5p	CLIP-seq
MIRT877732	hsa-miR-532-5p	CLIP-seq
MIRT1960104	hsa-miR-545	CLIP-seq
MIRT877733	hsa-miR-548an	CLIP-seq
MIRT2196978	hsa-miR-548c-3p	CLIP-seq
MIRT1960105	hsa-miR-558	CLIP-seq
MIRT2196979	hsa-miR-567	CLIP-seq
MIRT877734	hsa-miR-579	CLIP-seq
MIRT1960106	hsa-miR-583	CLIP-seq
MIRT2196980	hsa-miR-587	CLIP-seq
MIRT877735	hsa-miR-607	CLIP-seq
MIRT1960108	hsa-miR-613	CLIP-seq
MIRT877694	hsa-miR-616	CLIP-seq
MIRT877695	hsa-miR-625	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT877697	hsa-miR-654-3p	CLIP-seq
MIRT877736	hsa-miR-664	CLIP-seq
MIRT877698	hsa-miR-759	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877700	hsa-miR-766	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT2196981	hsa-miR-891b	CLIP-seq
MIRT2196982	hsa-miR-924	CLIP-seq
MIRT877702	hsa-miR-92a	CLIP-seq
MIRT877703	hsa-miR-92b	CLIP-seq
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877639	hsa-miR-1257	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT877708	hsa-miR-1909	CLIP-seq
MIRT877644	hsa-miR-25	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877712	hsa-miR-3132	CLIP-seq
MIRT877652	hsa-miR-3140-3p	CLIP-seq
MIRT877655	hsa-miR-32	CLIP-seq
MIRT877658	hsa-miR-363	CLIP-seq
MIRT1960081	hsa-miR-3660	CLIP-seq
MIRT877659	hsa-miR-367	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT1960085	hsa-miR-4256	CLIP-seq
MIRT877668	hsa-miR-4270	CLIP-seq
MIRT877670	hsa-miR-4275	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT877672	hsa-miR-4441	CLIP-seq
MIRT1960095	hsa-miR-4526	CLIP-seq
MIRT877674	hsa-miR-4528	CLIP-seq
MIRT2196973	hsa-miR-4639-5p	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877678	hsa-miR-4666-3p	CLIP-seq
MIRT877728	hsa-miR-4761-3p	CLIP-seq
MIRT1960101	hsa-miR-4762-3p	CLIP-seq
MIRT877688	hsa-miR-516b	CLIP-seq
MIRT877689	hsa-miR-518a-5p	CLIP-seq
MIRT877690	hsa-miR-520a-5p	CLIP-seq
MIRT877691	hsa-miR-525-5p	CLIP-seq
MIRT877692	hsa-miR-527	CLIP-seq
MIRT877693	hsa-miR-548ad	CLIP-seq
MIRT877694	hsa-miR-616	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT877698	hsa-miR-759	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT877702	hsa-miR-92a	CLIP-seq
MIRT877703	hsa-miR-92b	CLIP-seq
MIRT877706	hsa-miR-18a	CLIP-seq
MIRT877707	hsa-miR-18b	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT877723	hsa-miR-4659a-3p	CLIP-seq
MIRT877724	hsa-miR-4659b-3p	CLIP-seq
MIRT877725	hsa-miR-4729	CLIP-seq
MIRT877726	hsa-miR-4735-3p	CLIP-seq
MIRT877734	hsa-miR-579	CLIP-seq
MIRT2196955	hsa-miR-141	CLIP-seq
MIRT2196957	hsa-miR-200a	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT1960070	hsa-miR-1	CLIP-seq
MIRT877637	hsa-miR-1226	CLIP-seq
MIRT877638	hsa-miR-1238	CLIP-seq
MIRT877704	hsa-miR-1243	CLIP-seq
MIRT877641	hsa-miR-1272	CLIP-seq
MIRT2677831	hsa-miR-1283	CLIP-seq
MIRT877643	hsa-miR-1322	CLIP-seq
MIRT2196955	hsa-miR-141	CLIP-seq
MIRT2196956	hsa-miR-1827	CLIP-seq
MIRT877705	hsa-miR-185	CLIP-seq
MIRT877706	hsa-miR-18a	CLIP-seq
MIRT877707	hsa-miR-18b	CLIP-seq
MIRT877708	hsa-miR-1909	CLIP-seq
MIRT2196957	hsa-miR-200a	CLIP-seq
MIRT877709	hsa-miR-200b	CLIP-seq
MIRT877710	hsa-miR-200c	CLIP-seq
MIRT755936	hsa-miR-206	CLIP-seq
MIRT2196958	hsa-miR-2110	CLIP-seq
MIRT1960074	hsa-miR-224	CLIP-seq
MIRT877644	hsa-miR-25	CLIP-seq
MIRT2677832	hsa-miR-28-3p	CLIP-seq
MIRT877645	hsa-miR-2964a-5p	CLIP-seq
MIRT877646	hsa-miR-298	CLIP-seq
MIRT877711	hsa-miR-299-3p	CLIP-seq
MIRT877647	hsa-miR-29a	CLIP-seq
MIRT877648	hsa-miR-29b	CLIP-seq
MIRT877649	hsa-miR-29c	CLIP-seq
MIRT877650	hsa-miR-3065-5p	CLIP-seq
MIRT1960077	hsa-miR-31	CLIP-seq
MIRT2677833	hsa-miR-3122	CLIP-seq
MIRT2196959	hsa-miR-3124-3p	CLIP-seq
MIRT2196960	hsa-miR-3127-3p	CLIP-seq
MIRT877712	hsa-miR-3132	CLIP-seq
MIRT877652	hsa-miR-3140-3p	CLIP-seq
MIRT877713	hsa-miR-3148	CLIP-seq
MIRT877653	hsa-miR-3153	CLIP-seq
MIRT1960080	hsa-miR-3184	CLIP-seq
MIRT2196962	hsa-miR-3190	CLIP-seq
MIRT877655	hsa-miR-32	CLIP-seq
MIRT2677834	hsa-miR-320e	CLIP-seq
MIRT2196964	hsa-miR-3613-3p	CLIP-seq
MIRT877715	hsa-miR-361-5p	CLIP-seq
MIRT877658	hsa-miR-363	CLIP-seq
MIRT2196967	hsa-miR-3646	CLIP-seq
MIRT2196968	hsa-miR-3653	CLIP-seq
MIRT877716	hsa-miR-3654	CLIP-seq
MIRT2196969	hsa-miR-3658	CLIP-seq
MIRT2196970	hsa-miR-3663-3p	CLIP-seq
MIRT2196971	hsa-miR-3667-3p	CLIP-seq
MIRT877659	hsa-miR-367	CLIP-seq
MIRT877717	hsa-miR-3671	CLIP-seq
MIRT1960082	hsa-miR-3673	CLIP-seq
MIRT2677835	hsa-miR-3913-5p	CLIP-seq
MIRT877665	hsa-miR-3925-3p	CLIP-seq
MIRT877666	hsa-miR-3944-5p	CLIP-seq
MIRT2677836	hsa-miR-3978	CLIP-seq
MIRT877667	hsa-miR-421	CLIP-seq
MIRT1960083	hsa-miR-423-5p	CLIP-seq
MIRT2677837	hsa-miR-4261	CLIP-seq
MIRT2677838	hsa-miR-4263	CLIP-seq
MIRT877668	hsa-miR-4270	CLIP-seq
MIRT877669	hsa-miR-4271	CLIP-seq
MIRT877718	hsa-miR-4276	CLIP-seq
MIRT877719	hsa-miR-4282	CLIP-seq
MIRT877720	hsa-miR-429	CLIP-seq
MIRT877721	hsa-miR-4306	CLIP-seq
MIRT1960088	hsa-miR-4307	CLIP-seq
MIRT1960090	hsa-miR-433	CLIP-seq
MIRT2677839	hsa-miR-4422	CLIP-seq
MIRT877671	hsa-miR-4426	CLIP-seq
MIRT1960091	hsa-miR-4437	CLIP-seq
MIRT877672	hsa-miR-4441	CLIP-seq
MIRT2677840	hsa-miR-4464	CLIP-seq
MIRT1960092	hsa-miR-4470	CLIP-seq
MIRT2677841	hsa-miR-4476	CLIP-seq
MIRT2196972	hsa-miR-4477a	CLIP-seq
MIRT1960094	hsa-miR-4491	CLIP-seq
MIRT877674	hsa-miR-4528	CLIP-seq
MIRT877722	hsa-miR-4644	CLIP-seq
MIRT877675	hsa-miR-4647	CLIP-seq
MIRT877676	hsa-miR-4655-3p	CLIP-seq
MIRT1960096	hsa-miR-4657	CLIP-seq
MIRT877723	hsa-miR-4659a-3p	CLIP-seq
MIRT877724	hsa-miR-4659b-3p	CLIP-seq
MIRT877677	hsa-miR-4662b	CLIP-seq
MIRT2677842	hsa-miR-4668-3p	CLIP-seq
MIRT877679	hsa-miR-4668-5p	CLIP-seq
MIRT2677843	hsa-miR-4670-3p	CLIP-seq
MIRT1960097	hsa-miR-4674	CLIP-seq
MIRT1960098	hsa-miR-4688	CLIP-seq
MIRT2196976	hsa-miR-4699-3p	CLIP-seq
MIRT877682	hsa-miR-4725-3p	CLIP-seq
MIRT877725	hsa-miR-4729	CLIP-seq
MIRT877726	hsa-miR-4735-3p	CLIP-seq
MIRT2677844	hsa-miR-4738-3p	CLIP-seq
MIRT877684	hsa-miR-4747-5p	CLIP-seq
MIRT2677845	hsa-miR-4748	CLIP-seq
MIRT877727	hsa-miR-4760-3p	CLIP-seq
MIRT877728	hsa-miR-4761-3p	CLIP-seq
MIRT2677846	hsa-miR-4766-5p	CLIP-seq
MIRT2677847	hsa-miR-4772-3p	CLIP-seq
MIRT2677848	hsa-miR-4775	CLIP-seq
MIRT877686	hsa-miR-4777-3p	CLIP-seq
MIRT1960103	hsa-miR-4779	CLIP-seq
MIRT2677849	hsa-miR-4795-5p	CLIP-seq
MIRT2677850	hsa-miR-4799-5p	CLIP-seq
MIRT2196977	hsa-miR-4800-3p	CLIP-seq
MIRT877729	hsa-miR-488	CLIP-seq
MIRT877689	hsa-miR-518a-5p	CLIP-seq
MIRT877690	hsa-miR-520a-5p	CLIP-seq
MIRT877730	hsa-miR-520d-5p	CLIP-seq
MIRT877731	hsa-miR-524-5p	CLIP-seq
MIRT877691	hsa-miR-525-5p	CLIP-seq
MIRT877692	hsa-miR-527	CLIP-seq
MIRT2677851	hsa-miR-539	CLIP-seq
MIRT1960104	hsa-miR-545	CLIP-seq
MIRT877693	hsa-miR-548ad	CLIP-seq
MIRT877733	hsa-miR-548an	CLIP-seq
MIRT2196978	hsa-miR-548c-3p	CLIP-seq
MIRT2196979	hsa-miR-567	CLIP-seq
MIRT2677852	hsa-miR-569	CLIP-seq
MIRT2677853	hsa-miR-576-5p	CLIP-seq
MIRT877734	hsa-miR-579	CLIP-seq
MIRT1960106	hsa-miR-583	CLIP-seq
MIRT2196980	hsa-miR-587	CLIP-seq
MIRT2677854	hsa-miR-590-3p	CLIP-seq
MIRT2677855	hsa-miR-603	CLIP-seq
MIRT2677856	hsa-miR-605	CLIP-seq
MIRT877735	hsa-miR-607	CLIP-seq
MIRT1960108	hsa-miR-613	CLIP-seq
MIRT877694	hsa-miR-616	CLIP-seq
MIRT877696	hsa-miR-646	CLIP-seq
MIRT2677857	hsa-miR-659	CLIP-seq
MIRT877736	hsa-miR-664	CLIP-seq
MIRT877698	hsa-miR-759	CLIP-seq
MIRT877699	hsa-miR-760	CLIP-seq
MIRT877700	hsa-miR-766	CLIP-seq
MIRT877701	hsa-miR-888	CLIP-seq
MIRT2196981	hsa-miR-891b	CLIP-seq
MIRT2196982	hsa-miR-924	CLIP-seq
MIRT877702	hsa-miR-92a	CLIP-seq
MIRT877703	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PTTG1	Activation	22081074

129

Show/Hide all (129)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000322	Component	Storage vacuole	IEA
GO:0003015	Process	Heart process	IEA
GO:0003161	Process	Cardiac conduction system development	IEA
GO:0003253	Process	Cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	19787194, 27917469
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	11035016
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	7493928, 7512369, 9082982, 9262406, 9418861, 9422512, 9660763, 9846874, 10051605, 10360579, 10587647, 10816584, 10934474, 11035016, 11157984, 11260256, 11807099, 11889037, 12006984, 12093730, 12606577, 12745076, 12879077, 14676191, 15194684, 15361624, 15728724, 16189514, 16293614, 16
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	8625410, 15601624, 23620790
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11260256
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005813	Component	Centrosome	IDA	20873783
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11260256
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006897	Process	Endocytosis	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0006911	Process	Phagocytosis, engulfment	IMP	26465210
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IMP	26465210
GO:0007030	Process	Golgi organization	ISS
GO:0007088	Process	Regulation of mitotic nuclear division	IEA
GO:0007097	Process	Nuclear migration	IEA
GO:0007163	Process	Establishment or maintenance of cell polarity	TAS	11260256
GO:0007165	Process	Signal transduction	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	26051942
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0010591	Process	Regulation of lamellipodium assembly	IGI	8625410
GO:0010592	Process	Positive regulation of lamellipodium assembly	IMP	8625410
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	11807099
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	IMP	22801373
GO:0016787	Function	Hydrolase activity	IEA
GO:0017119	Component	Golgi transport complex	IMP	16380373
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IDA	19039103
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8625410, 20873783, 21048939
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030036	Process	Actin cytoskeleton organization	IDA	11035016
GO:0030154	Process	Cell differentiation	IEA
GO:0030175	Component	Filopodium	IDA	11035016
GO:0030225	Process	Macrophage differentiation	TAS	11260256
GO:0030307	Process	Positive regulation of cell growth	IMP	21435037
GO:0030335	Process	Positive regulation of cell migration	IMP	20023705
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IDA	15642749
GO:0030496	Component	Midbody	IEA
GO:0030742	Function	GTP-dependent protein binding	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0031256	Component	Leading edge membrane	IEA
GO:0031274	Process	Positive regulation of pseudopodium assembly	IDA	11035016
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IPI	11584266
GO:0031996	Function	Thioesterase binding	IPI	12612085
GO:0032427	Function	GBD domain binding	IPI	8625410, 10724160
GO:0032467	Process	Positive regulation of cytokinesis	IMP	15642749
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	26051942
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0034191	Function	Apolipoprotein A-I receptor binding	IPI	16443932
GO:0034329	Process	Cell junction assembly	IMP	22891260
GO:0034332	Process	Adherens junction organization	IEA
GO:0035050	Process	Embryonic heart tube development	IEA
GO:0035088	Process	Establishment or maintenance of apical/basal cell polarity	IEA
GO:0036336	Process	Dendritic cell migration	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0038189	Process	Neuropilin signaling pathway	IMP	26051942
GO:0042802	Function	Identical protein binding	IPI	9748241
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	21048939
GO:0043025	Component	Neuronal cell body	IDA	21048939
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0044788	Process	Host-mediated perturbation of viral process	IMP	19376974
GO:0045177	Component	Apical part of cell	IEA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	22891260
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046847	Process	Filopodium assembly	IEA
GO:0048549	Process	Positive regulation of pinocytosis	IEA
GO:0048549	Process	Positive regulation of pinocytosis	ISS
GO:0048664	Process	Neuron fate determination	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051233	Component	Spindle midzone	IDA	15642749
GO:0051489	Process	Regulation of filopodium assembly	IBA
GO:0051489	Process	Regulation of filopodium assembly	IDA	14978216
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IMP	26051942
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0051492	Process	Regulation of stress fiber assembly	IGI	8625410
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	8625410, 26051942
GO:0051647	Process	Nucleus localization	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051683	Process	Establishment of Golgi localization	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051988	Process	Regulation of attachment of spindle microtubules to kinetochore	IMP	15642749
GO:0060047	Process	Heart contraction	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060997	Process	Dendritic spine morphogenesis	IEA
GO:0060997	Process	Dendritic spine morphogenesis	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	21435037
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072384	Process	Organelle transport along microtubule	ISS
GO:0072686	Component	Mitotic spindle	IDA	15642749
GO:0086101	Process	Endothelin receptor signaling pathway involved in heart process	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	11807099

MIM	HGNC	e!Ensembl
116952	1736	ENSG00000070831

P60953

Protein name

Cell division control protein 42 homolog (EC 3.6.5.2) (G25K GTP-binding protein)

Protein function

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization pr

PDB

1A4R , 1AJE , 1AM4 , 1AN0 , 1CEE , 1CF4 , 1DOA , 1E0A , 1EES , 1GRN , 1GZS , 1KI1 , 1KZ7 , 1KZG , 1NF3 , 2ASE , 2DFK , 2KB0 , 2NGR , 2ODB , 2QRZ , 2WM9 , 2WMN , 2WMO , 3GCG , 3QBV , 3VHL , 4DID , 4ITR , 4JS0 , 4YC7 , 4YDH , 5CJP , 5FI1 , 5HZK , 5UPK , 5UPL , 6AJ4 , 6AJL , 6SIU , 6SUP , 6TKY , 6TKZ , 7S0Y , 8I5F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 178	Ras family	Domain

Sequence

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL

Sequence length

191

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Chemokine signaling pathway Endocytosis Axon guidance VEGF signaling pathway Focal adhesion Adherens junction Tight junction T cell receptor signaling pathway Fc gamma R-mediated phagocytosis Leukocyte transendothelial migration Neurotrophin signaling pathway Regulation of actin cytoskeleton GnRH signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Bacterial invasion of epithelial cells Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Yersinia infection Human papillomavirus infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer Renal cell carcinoma Pancreatic cancer Lipid and atherosclerosis		GPVI-mediated activation cascade EGFR downregulation Rho GTPase cycle Regulation of actin dynamics for phagocytic cup formation CD28 dependent Vav1 pathway EPHB-mediated forward signaling DCC mediated attractive signaling VEGFA-VEGFR2 Pathway Myogenesis RHO GTPases activate KTN1 RHO GTPases activate IQGAPs RHO GTPases activate PAKs RHO GTPases Activate WASPs and WAVEs RHO GTPases Activate Formins MAPK6/MAPK4 signaling Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation G beta:gamma signalling through CDC42 FCGR3A-mediated phagocytosis Factors involved in megakaryocyte development and platelet production

Show/Hide Causal Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal facial shape	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196134, rs1553196539	RCV001291420 RCV001291422 RCV001291421 RCV001291419 RCV001291424 RCV001291423 RCV001291425 RCV001291426 RCV001291162
Abnormality of blood and blood-forming tissues	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196134, rs1553196539	RCV001291420 RCV001291422 RCV001291421 RCV001291419 RCV001291424 RCV001291423 RCV001291425 RCV001291426 RCV001291162
Abnormality of the immune system	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196134, rs1553196539	RCV001291420 RCV001291422 RCV001291421 RCV001291419 RCV001291424 RCV001291423 RCV001291425 RCV001291426 RCV001291162
CDC42-associated inflammatory disease	Pathogenic	rs2522255954	RCV005417362
CDC42-related disorder	Pathogenic; Likely pathogenic	rs797044916, rs2522255949	RCV004739574 RCV003335877
Familial hemophagocytic lymphohistiocytosis	Pathogenic	rs2522255954	RCV006249826
Macrothrombocytopenia-lymphedema-developmental delay-facial dysmorphism-camptodactyly syndrome	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1645663483, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196539, rs1570024112	RCV002509288 RCV000601199 RCV000203307 RCV003458288 RCV000601771 RCV000604971 RCV001332038 RCV000611080 RCV000607619 RCV000824997
Neurodevelopmental abnormality	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196134, rs1553196539	RCV001291420 RCV001291422 RCV001291421 RCV001291419 RCV001291424 RCV001291423 RCV001291425 RCV001291426 RCV001291162
Neurodevelopmental disorder	Pathogenic	rs797044916	RCV001374925
Noonan-like syndrome	Pathogenic	rs1553196539	RCV000577848
Postnatal growth retardation	Pathogenic; Likely pathogenic	rs797044916, rs797044870, rs864309721, rs1064795845, rs1553196100, rs1553196096, rs1553196101, rs1553196134, rs1553196539	RCV001291420 RCV001291422 RCV001291421 RCV001291419 RCV001291424 RCV001291423 RCV001291425 RCV001291426 RCV001291162
See cases	Likely pathogenic	rs2124053783	RCV001420290

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adrenocortical carcinoma, hereditary	Benign	rs1349667730	RCV005871240
Clear cell carcinoma of kidney	Likely benign	rs370073568	RCV005926116
Colon adenocarcinoma	Benign	rs1349667730	RCV005871239
Malignant tumor of esophagus	Likely benign	rs370073568	RCV005926115

Show/Hide Text Mining Associations (134)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aarskog Syndrome	Associate	12771149, 21356349
Adams Oliver syndrome	Associate	27693507, 36059114
Adenocarcinoma of Lung	Associate	32733636
Adenoma	Stimulate	37365287
Adenomatous Polyposis Coli	Associate	17145773
Anophthalmos with limb anomalies	Associate	21565291
Arthritis Rheumatoid	Associate	27498552
Asthenozoospermia	Associate	23174138
Asthma	Associate	28479334, 36194662
Atrial Fibrillation	Associate	35003319
Autoimmune Diseases	Associate	35104386, 35527674, 36952639
Band Heterotopia of Brain	Associate	33672558
Breast Neoplasms	Associate	17356711, 17538024, 23420497, 23975422, 25273174, 29971782, 30420728, 35087170, 36077333, 37511111
Breast Neoplasms	Inhibit	28423712, 29994716
Carcinogenesis	Associate	22589722, 25208761, 27100492, 28035419, 28282856, 32231661
Carcinoma Hepatocellular	Associate	23894465, 25472720, 30543848, 33380242, 35340237
Carcinoma Hepatocellular	Stimulate	28282856
Carcinoma Non Small Cell Lung	Associate	26462147, 32841053
Carcinoma Non Small Cell Lung	Stimulate	34952984
Carcinoma Ovarian Epithelial	Associate	26391404, 30795761, 32901852
Carcinoma Pancreatic Ductal	Associate	32376602
Carcinoma Papillary	Associate	30171198
Carcinoma Renal Cell	Associate	23521319
Carcinoma Squamous Cell	Associate	28204826
Cerebral Infarction	Inhibit	23696594
Cleft Lip	Associate	34024335
Cleft Palate	Inhibit	34024335
Cognitive Dysfunction	Associate	37581646
Colitis Ulcerative	Inhibit	35527674
Colonic Neoplasms	Associate	21943101, 23144867
Colonic Polyps	Associate	37365287
Colorectal Neoplasms	Associate	15309713, 22543585, 23144867, 24817781, 27769041, 31262449, 32139668, 37950620
Colorectal Neoplasms	Stimulate	35735582
Coronary Artery Disease	Inhibit	31886261
Developmental Disabilities	Associate	29394990, 30290153, 37501076
Diabetes Mellitus Type 2	Associate	33149760
Diabetic Nephropathies	Associate	21752957, 23902294
Dyserythropoietic Anemia with Thrombocytopenia	Associate	36952639
Esophageal Neoplasms	Associate	33484472
Esophageal Squamous Cell Carcinoma	Associate	24025765, 25400770, 27120794, 32139664, 32901852, 36112883
Facial Dysmorphism with Multiple Malformations	Associate	29394990, 32231661
Fetal Growth Retardation	Inhibit	31825077
Fibrosis	Associate	35176481
Gait Ataxia	Associate	30290153
Genetic Diseases Inborn	Associate	33672558
Glioblastoma	Associate	23677714, 29207169, 39390804
Glioma	Associate	28035419, 36870986
Glomerulonephritis	Associate	26986510
Glucosephosphate Dehydrogenase Deficiency	Associate	33171523
Growth Disorders	Stimulate	24762475
Growth Disorders	Associate	29394990
Head and Neck Neoplasms	Associate	20345482
Hearing Loss	Associate	33809266
Heart Diseases	Associate	32303876
Hematologic Diseases	Associate	32231661, 32303876, 34504210
Hematologic Neoplasms	Associate	29394990
Hepatitis C	Associate	33785040
Hereditary Autoinflammatory Diseases	Associate	32231661, 37581646
Hernia Inguinal	Associate	31910207
HIV Infections	Inhibit	15574879
Hodgkin Disease	Associate	32231661
Hypersensitivity Delayed	Associate	32231661
Hypopharyngeal Neoplasms	Associate	35484886
Hypoxia	Associate	21357506, 24762475
Hypoxia	Stimulate	32671953
Idiopathic Pulmonary Fibrosis	Inhibit	33402146
Immunologic Deficiency Syndromes	Associate	32231661
Immunologic Deficiency Syndromes	Stimulate	37019085
Infections	Associate	32231661, 33672558, 37581646, 40353220
Inflammation	Associate	28479334, 29921325, 35527674
Inflammatory Bowel Diseases	Associate	30581272
Leiomyoma	Associate	16854417
Leukoencephalopathies	Associate	39202455
Lung Neoplasms	Associate	19154401, 26462147, 28204826, 34321041
Lymphatic Metastasis	Stimulate	34952984
Lymphohistiocytosis Hemophagocytic	Associate	32231661, 37581646
Lymphopenia	Associate	37581646
Megalencephaly	Associate	30290153
Melanoma	Stimulate	10587647
Melanoma	Associate	12482591, 18835169, 27347659, 30582770, 37114375, 38008393
Melanoma Cutaneous Malignant	Associate	27347659
Menkes Kinky Hair Syndrome	Associate	27685868
Mesothelioma Malignant	Associate	29845703
Metabolic Syndrome	Inhibit	26004609
Microcephaly	Associate	37501076
Microvillus inclusion disease	Associate	26526116
Muscle Neoplasms	Associate	36194662
Myocardial Infarction	Stimulate	35537778
Myotonic Dystrophy	Associate	30667325
Nasopharyngeal Carcinoma	Associate	22589722
Necrosis	Associate	19430526
Neoplasm Metastasis	Associate	15309713, 19154401, 26462147, 28281966, 32139668, 33946672, 34952984, 37024613
Neoplasm Metastasis	Inhibit	23420497
Neoplasms	Associate	10480914, 10587647, 12482591, 15928809, 18541705, 18835169, 19416857, 19568410, 20067638, 21295525, 24025765, 24747643, 25097177, 25379703, 25400770 View all (25 more)
Nephrosis congenital	Associate	26986510
Neurilemmoma	Associate	19409384
Neuroblastoma	Associate	15350548, 28860601
Neuroblastoma	Stimulate	25264923
Neurofibromatosis Noonan syndrome	Associate	30290153
Non alcoholic Fatty Liver Disease	Associate	26845596
Noonan Syndrome	Associate	29394990
Obesity	Associate	28479334, 36194662
Osteoarthritis	Associate	31886203
Ovarian Cysts	Associate	16854417
Ovarian Diseases	Associate	16854417
Ovarian Neoplasms	Associate	22610942, 26071482, 31262449
Pancreatic Neoplasms	Associate	23426533, 27145964, 29853638, 32232899, 34782370
Pancreatitis	Associate	27100492
Pancytopenia	Associate	33672558
Parkinson Disease	Associate	22135858
Pneumonia	Associate	15574879
Primary Immunodeficiency Diseases	Associate	32265901
Primary Myelofibrosis	Associate	27341078, 32303876
Proteinuria	Associate	26986510
Psoriasis	Associate	33416099
Pulmonary Disease Chronic Obstructive	Associate	36221429
Seizures	Associate	30290153
Severe Combined Immunodeficiency	Associate	32265901
Smoke Inhalation Injury	Associate	28816646
Spondylitis Ankylosing	Associate	35104386
Squamous Cell Carcinoma of Head and Neck	Associate	25405202
Squamous Intraepithelial Lesions	Stimulate	28859048
Stomach Diseases	Associate	36356476
Stomach Neoplasms	Associate	32679742, 34650666, 36064550, 36356476, 36631800, 36792578, 38336288
Stroke	Inhibit	23696594
Thrombocytopenia	Associate	37581646
Thrombocytopenia 1	Associate	20130240
Thyroid Cancer Papillary	Associate	17296934
Trichohepatoenteric Syndrome	Associate	26526116
Triple Negative Breast Neoplasms	Associate	33205415, 35087170, 36077333, 36693952
Uterine Cervical Neoplasms	Associate	30962261, 36929174
Wiskott Aldrich Syndrome	Associate	10953003, 16246732, 18393378, 27685868
Wiskott Aldrich Syndrome	Stimulate	23455509
X Linked Combined Immunodeficiency Diseases	Associate	37581646

CDC42 (cell division cycle 42)