RBX1 (ring-box 1)

Gene

• Entrez ID: 9978
• Gene name: Ring-box 1
• Gene symbol: RBX1
• Synonyms (NCBI Gene): BA554C12.1, RNF75, ROC1
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT049206	hsa-miR-92a-3p	CLASH	23622248
MIRT054190	hsa-miR-194-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25412959
MIRT054190	hsa-miR-194-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25412959
MIRT719975	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT719974	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719973	hsa-miR-5187-3p	HITS-CLIP	19536157
MIRT719972	hsa-miR-4513	HITS-CLIP	19536157
MIRT719971	hsa-miR-6855-3p	HITS-CLIP	19536157
MIRT719970	hsa-miR-6857-3p	HITS-CLIP	19536157
MIRT719969	hsa-miR-188-3p	HITS-CLIP	19536157
MIRT719968	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719967	hsa-miR-3136-5p	HITS-CLIP	19536157
MIRT719966	hsa-miR-4439	HITS-CLIP	19536157
MIRT719965	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT719975	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT719974	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719973	hsa-miR-5187-3p	HITS-CLIP	19536157
MIRT719972	hsa-miR-4513	HITS-CLIP	19536157
MIRT719971	hsa-miR-6855-3p	HITS-CLIP	19536157
MIRT719970	hsa-miR-6857-3p	HITS-CLIP	19536157
MIRT719969	hsa-miR-188-3p	HITS-CLIP	19536157
MIRT719968	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719967	hsa-miR-3136-5p	HITS-CLIP	19536157
MIRT719966	hsa-miR-4439	HITS-CLIP	19536157
MIRT719965	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297522	hsa-miR-3180-5p	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT1297538	hsa-miR-514	CLIP-seq
MIRT1297539	hsa-miR-514b-3p	CLIP-seq
MIRT1297540	hsa-miR-520a-5p	CLIP-seq
MIRT1297541	hsa-miR-525-5p	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT1297538	hsa-miR-514	CLIP-seq
MIRT1297539	hsa-miR-514b-3p	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2609707	hsa-miR-1264	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT2609708	hsa-miR-3134	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT2609709	hsa-miR-3185	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2609710	hsa-miR-4534	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2609711	hsa-miR-7	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT2609707	hsa-miR-1264	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT2609708	hsa-miR-3134	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT2609709	hsa-miR-3185	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2609710	hsa-miR-4534	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2689596	hsa-miR-4731-3p	CLIP-seq
MIRT2689597	hsa-miR-4801	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2609711	hsa-miR-7	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	IDA	14528312
GO:0000423	Process	Mitophagy	IMP	22505714
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15983046, 20389280
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	11961546, 12504026, 12609982, 15601820, 17183367, 17543862, 18239684, 18805092, 18826954, 19250909, 19327355, 19549727, 20399188, 21765416, 22660580, 23238014, 23274085, 23401859, 24192928, 24793696, 24949976, 25619834, 25684205, 26496610, 26906416, 29149593, 29294217, 30945288, 322
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	11027288, 20870715, 27626656
GO:0005634	Component	Nucleus	IDA	11027288
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	22118460
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IC	27708159, 36394357
GO:0005737	Component	Cytoplasm	IDA	27708159, 34065512
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	IDA	38316879
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	IDA	34526721
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9852112
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	17636018, 18498745
GO:0006513	Process	Protein monoubiquitination	IDA	22358839
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006915	Process	Apoptotic process	IDA	34480022
GO:0006974	Process	DNA damage response	EXP	22118460
GO:0006974	Process	DNA damage response	IDA	26124108, 30171069
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0006979	Process	Response to oxidative stress	IDA	36075446
GO:0007040	Process	Lysosome organization	IDA	24448649
GO:0007283	Process	Spermatogenesis	IDA	34065512
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0008270	Function	Zinc ion binding	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	38056462
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010508	Process	Positive regulation of autophagy	IDA	22017875, 22017876
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	15103331, 17543862, 20389280, 34526721
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IPI	14739464
GO:0016740	Function	Transferase activity	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	11956208, 15103331, 21572392, 23263282, 25585578
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	12743296
GO:0019788	Function	NEDD8 transferase activity	TAS
GO:0030163	Process	Protein catabolic process	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IDA	29681526
GO:0030891	Component	VCB complex	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	30171069
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	15103331, 22017875, 22017876, 24936062, 26124108, 30171069, 36608670
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IBA
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IDA	22405651
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IDA	17636018
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	14528312, 15983046, 17543862, 20389280, 22358839, 35687106, 38225631, 39504960, 39667934
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	EXP	22118460
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	12732143, 14739464, 17085480, 18794347, 20129063, 20223979
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IEA
GO:0031465	Component	Cul4B-RING E3 ubiquitin ligase complex	IDA	18794347
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	17636018
GO:0031467	Component	Cul7-RING ubiquitin ligase complex	IDA	18498745
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	17636018, 29769719
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708, 32561715
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	34102342
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IPI	14739464
GO:0032480	Process	Negative regulation of type I interferon production	IDA	36394357
GO:0032481	Process	Positive regulation of type I interferon production	IDA	17404045
GO:0032869	Process	Cellular response to insulin stimulus	IDA	27708159
GO:0034198	Process	Cellular response to amino acid starvation	IDA	35338845
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	10230407
GO:0034599	Process	Cellular response to oxidative stress	IDA	36075446
GO:0034599	Process	Cellular response to oxidative stress	IDA	15601839, 39880951
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034644	Process	Cellular response to UV	EXP	22118460
GO:0034644	Process	Cellular response to UV	IEA
GO:0034644	Process	Cellular response to UV	ISS
GO:0035279	Process	MiRNA-mediated gene silencing by mRNA destabilization	IDA	16289642
GO:0038066	Process	P38MAPK cascade	IDA	10330143, 11460167
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042110	Process	T cell activation	IDA	34065512
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	24936062
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10644755
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	25038658
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IC	36646384
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29681526
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	10230407, 15601839, 20389280, 23453970, 29769719, 34480022, 35687106, 38225631, 39504960, 39667934, 39880951
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045116	Process	Protein neddylation	IDA	19250909
GO:0045727	Process	Positive regulation of translation	IMP	28106072
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	11027288, 16482215, 27626656
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	18498745
GO:0046872	Function	Metal ion binding	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	11961546
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23391734
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	14739464
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IC	24936062, 26124108, 30171069
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	10230407, 11027288, 15601839, 16482215, 17636018, 18498745, 20870715, 22017875, 22017876, 22405651, 23453970, 27626656, 29779948, 34526721, 35687106, 36608670, 38225631, 39504960, 39667934, 39880951
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061663	Function	NEDD8 ligase activity	IDA	19250909
GO:0061663	Function	NEDD8 ligase activity	IEA
GO:0062197	Process	Cellular response to chemical stress	TAS
GO:0070294	Process	Renal sodium ion absorption	ISS	14608358, 17975670
GO:0070936	Process	Protein K48-linked ubiquitination	IC	36646384
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	15103331, 25684205, 27708159, 29658272
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IDA	29769719
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IDA	32355176, 34526721
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090734	Component	Site of DNA damage	IDA	34526721
GO:0097510	Process	Base-excision repair, AP site formation via deaminated base removal	IDA	18973764
GO:0097602	Function	Cullin family protein binding	IBA
GO:0097602	Function	Cullin family protein binding	IDA	10230407
GO:0097602	Function	Cullin family protein binding	IPI	14528312
GO:0140627	Process	Ubiquitin-dependent protein catabolic process via the C-end degron rule pathway	IDA	29779948, 34065512
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	39504960, 39667934
GO:1900076	Process	Regulation of cellular response to insulin stimulus	IC	27708159
GO:1901525	Process	Negative regulation of mitophagy	IC	17636018
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IDA	29681526
GO:1902499	Process	Positive regulation of protein autoubiquitination	IMP	14528312
GO:1902883	Process	Negative regulation of response to oxidative stress	IDA	11027288
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IDA	34480022
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	22017875, 22017876, 35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29769719
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	24424410, 39032648

Other IDs

• MIM: 603814
• HGNC: 9928
• e!Ensembl: ENSG00000100387

Protein

• UniProt ID: P62877
• Protein name: E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-term
• Protein function: E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progre
• PDB: 1LDJ, 1LDK, 1U6G, 2HYE, 2LGV, 3DPL, 3DQV, 3RTR, 4F52, 4P5O, 5N4W, 6R6H, 6R7F, 6R7H, 6R7I, 6R7N, 6TTU, 7B5L, 7B5M, 7B5N, 7B5S, 7OKQ, 7PLO, 7Z8B, 7Z8R, 7Z8T, 7Z8V, 7ZBW, 7ZBZ, 8B3G, 8B3I, 8CDJ, 8CDK, 8GQ6, 8H33, 8H34, 8H35, 8H36, 8H37, 8H38, 8H3A, 8H3F, 8H3Q, 8H3R, 8IJ1, 8JAQ, 8JAS, 8JAV, 8JE1, 8K9I, 8KHP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12678	zf-rbx1	40 → 98	RING-H2 zinc finger domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
  ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

• Sequence length: 108

Pathways

KEGG:

Nucleotide excision repair
HIF-1 signaling pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Shigellosis
Human immunodeficiency virus 1 infection
Pathways in cancer
Renal cell carcinoma

Reactome:

Recognition of DNA damage by PCNA-containing replication complex
Prolactin receptor signaling
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Vif-mediated degradation of APOBEC3G
Degradation of beta-catenin by the destruction complex
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Degradation of DVL
Degradation of GLI1 by the proteasome
GLI3 is processed to GLI3R by the proteasome
Hedgehog 'on' state
Regulation of RAS by GAPs
DNA Damage Recognition in GG-NER
Formation of Incision Complex in GG-NER
Dual Incision in GG-NER
Formation of TC-NER Pre-Incision Complex
Transcription-Coupled Nucleotide Excision Repair (TC-NER)
Dual incision in TC-NER
Gap-filling DNA repair synthesis and ligation in TC-NER
Orc1 removal from chromatin
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
Regulation of RUNX2 expression and activity
Neddylation
Interleukin-1 signaling
Antigen processing: Ubiquitination & Proteasome degradation