Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9978
Gene name Gene Name - the full gene name approved by the HGNC.	Ring-box 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RBX1
Synonyms (NCBI Gene) Gene synonyms aliases	BA554C12.1, RNF75, ROC1
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Re

Show/Hide all(177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049206	hsa-miR-92a-3p	CLASH	23622248
MIRT054190	hsa-miR-194-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25412959
MIRT054190	hsa-miR-194-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25412959
MIRT719975	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT719974	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719973	hsa-miR-5187-3p	HITS-CLIP	19536157
MIRT719972	hsa-miR-4513	HITS-CLIP	19536157
MIRT719971	hsa-miR-6855-3p	HITS-CLIP	19536157
MIRT719970	hsa-miR-6857-3p	HITS-CLIP	19536157
MIRT719969	hsa-miR-188-3p	HITS-CLIP	19536157
MIRT719968	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719967	hsa-miR-3136-5p	HITS-CLIP	19536157
MIRT719966	hsa-miR-4439	HITS-CLIP	19536157
MIRT719965	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT719975	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT719974	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719973	hsa-miR-5187-3p	HITS-CLIP	19536157
MIRT719972	hsa-miR-4513	HITS-CLIP	19536157
MIRT719971	hsa-miR-6855-3p	HITS-CLIP	19536157
MIRT719970	hsa-miR-6857-3p	HITS-CLIP	19536157
MIRT719969	hsa-miR-188-3p	HITS-CLIP	19536157
MIRT719968	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719967	hsa-miR-3136-5p	HITS-CLIP	19536157
MIRT719966	hsa-miR-4439	HITS-CLIP	19536157
MIRT719965	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297522	hsa-miR-3180-5p	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT1297538	hsa-miR-514	CLIP-seq
MIRT1297539	hsa-miR-514b-3p	CLIP-seq
MIRT1297540	hsa-miR-520a-5p	CLIP-seq
MIRT1297541	hsa-miR-525-5p	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT1297527	hsa-miR-3654	CLIP-seq
MIRT1297528	hsa-miR-378	CLIP-seq
MIRT1297529	hsa-miR-378b	CLIP-seq
MIRT1297530	hsa-miR-378c	CLIP-seq
MIRT1297531	hsa-miR-378d	CLIP-seq
MIRT1297532	hsa-miR-378e	CLIP-seq
MIRT1297533	hsa-miR-378f	CLIP-seq
MIRT1297534	hsa-miR-378h	CLIP-seq
MIRT1297535	hsa-miR-378i	CLIP-seq
MIRT1297536	hsa-miR-422a	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT1297538	hsa-miR-514	CLIP-seq
MIRT1297539	hsa-miR-514b-3p	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2609707	hsa-miR-1264	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT2609708	hsa-miR-3134	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT2609709	hsa-miR-3185	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2609710	hsa-miR-4534	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2609711	hsa-miR-7	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq
MIRT2609707	hsa-miR-1264	CLIP-seq
MIRT1297516	hsa-miR-135a	CLIP-seq
MIRT1297517	hsa-miR-135b	CLIP-seq
MIRT1297518	hsa-miR-194	CLIP-seq
MIRT1297519	hsa-miR-2054	CLIP-seq
MIRT1297520	hsa-miR-214	CLIP-seq
MIRT2457972	hsa-miR-23a	CLIP-seq
MIRT2457973	hsa-miR-23b	CLIP-seq
MIRT2457974	hsa-miR-23c	CLIP-seq
MIRT2088403	hsa-miR-3120-3p	CLIP-seq
MIRT2609708	hsa-miR-3134	CLIP-seq
MIRT1297521	hsa-miR-3153	CLIP-seq
MIRT2609709	hsa-miR-3185	CLIP-seq
MIRT1297523	hsa-miR-330-3p	CLIP-seq
MIRT1297524	hsa-miR-331-5p	CLIP-seq
MIRT1297525	hsa-miR-338-5p	CLIP-seq
MIRT1297526	hsa-miR-3619-5p	CLIP-seq
MIRT2313340	hsa-miR-3646	CLIP-seq
MIRT2457975	hsa-miR-375	CLIP-seq
MIRT2609710	hsa-miR-4534	CLIP-seq
MIRT1297537	hsa-miR-4666-3p	CLIP-seq
MIRT2457976	hsa-miR-4729	CLIP-seq
MIRT2689596	hsa-miR-4731-3p	CLIP-seq
MIRT2689597	hsa-miR-4801	CLIP-seq
MIRT2313341	hsa-miR-495	CLIP-seq
MIRT2088404	hsa-miR-545	CLIP-seq
MIRT2088405	hsa-miR-548v	CLIP-seq
MIRT1297542	hsa-miR-642b	CLIP-seq
MIRT2609711	hsa-miR-7	CLIP-seq
MIRT1297543	hsa-miR-761	CLIP-seq

Show/Hide all(67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	IDA	14528312
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15983046, 20389280
GO:0005515	Function	Protein binding	IPI	11961546, 12504026, 12609982, 15601820, 17183367, 18239684, 18805092, 18826954, 19250909, 19327355, 19549727, 20399188, 21765416, 22660580, 23238014, 23274085, 23401859, 24192928, 24793696, 24949976, 26496610, 26906416, 29149593, 29294217, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006293	Process	Nucleotide-excision repair, preincision complex stabilization	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006295	Process	Nucleotide-excision repair, DNA incision, 3'-to lesion	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0006513	Process	Protein monoubiquitination	IDA	22358839
GO:0008134	Function	Transcription factor binding	IPI	14739464
GO:0008270	Function	Zinc ion binding	IEA
GO:0010265	Process	SCF complex assembly	TAS
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IDA	15103331, 17543862, 20389280
GO:0016567	Process	Protein ubiquitination	IPI	14739464
GO:0016567	Process	Protein ubiquitination	TAS
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	11956208, 15103331, 21572392, 23263282, 25585578
GO:0019005	Component	SCF ubiquitin ligase complex	ISS
GO:0019788	Function	NEDD8 transferase activity	TAS
GO:0030891	Component	VCB complex	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	15103331
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IBA	21873635
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IDA	22405651
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IDA	17636018
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	14528312, 15983046, 17543862, 20389280, 22358839
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	12732143, 14739464, 17085480, 18794347, 20129063, 20223979
GO:0031465	Component	Cul4B-RING E3 ubiquitin ligase complex	IDA	18794347
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	17636018
GO:0031467	Component	Cul7-RING ubiquitin ligase complex	IDA	18498745
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	17636018
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IPI	14739464
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	10230407
GO:0042769	Process	DNA damage response, detection of DNA damage	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	20389280
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045116	Process	Protein neddylation	IDA	19250909
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	10230407, 22405651
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061663	Function	NEDD8 ligase activity	IDA	19250909
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0097602	Function	Cullin family protein binding	IBA	21873635
GO:0097602	Function	Cullin family protein binding	IDA	10230407
GO:0097602	Function	Cullin family protein binding	IPI	14528312
GO:1902499	Process	Positive regulation of protein autoubiquitination	IMP	14528312

MIM	HGNC	e!Ensembl
603814	9928	ENSG00000100387

Protein

UniProt ID

P62877

Protein name

E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-term

Protein function

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progre

PDB

1LDJ , 1LDK , 1U6G , 2HYE , 2LGV , 3DPL , 3DQV , 3RTR , 4F52 , 4P5O , 5N4W , 6R6H , 6R7F , 6R7H , 6R7I , 6R7N , 6TTU , 7B5L , 7B5M , 7B5N , 7B5S , 7OKQ , 7PLO , 7Z8B , 7Z8R , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8B3G , 8B3I , 8CDJ , 8CDK , 8GQ6 , 8H33 , 8H34 , 8H35 , 8H36 , 8H37 , 8H38 , 8H3A , 8H3F , 8H3Q , 8H3R , 8IJ1 , 8JAQ , 8JAS , 8JAV , 8JE1 , 8K9I , 8KHP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12678	zf-rbx1	40 → 98	RING-H2 zinc finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Sequence length

108

Interactions

View interactions

	KEGG		Reactome
	Nucleotide excision repair HIF-1 signaling pathway Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Protein processing in endoplasmic reticulum Wnt signaling pathway TGF-beta signaling pathway Circadian rhythm Shigellosis Human immunodeficiency virus 1 infection Pathways in cancer Renal cell carcinoma		Recognition of DNA damage by PCNA-containing replication complex Prolactin receptor signaling Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Vif-mediated degradation of APOBEC3G Degradation of beta-catenin by the destruction complex Constitutive Signaling by NOTCH1 PEST Domain Mutants Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Degradation of DVL Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Dual Incision in GG-NER Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Orc1 removal from chromatin FBXL7 down-regulates AURKA during mitotic entry and in early mitosis Regulation of RUNX2 expression and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Schizophrenia	Schizophrenia	GWAS
Crohn Disease	Crohn Disease	GWAS
Neuroticism	Neuroticism	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	28946546, 30237511
Carcinoma Hepatocellular	Associate	22935614, 25540389
Carcinoma Hepatocellular	Stimulate	22965024
Carcinoma Renal Cell	Associate	28946546
Chromosomal Instability	Associate	33290867, 36496990
Colorectal Neoplasms	Associate	34237211
Diabetes Gestational	Associate	33890634
Encephalitis Herpes Simplex	Associate	19509229
Endometrial Neoplasms	Associate	34082605
Esophageal Neoplasms	Associate	34281459
Glomus vagale tumors	Associate	22405651, 22748924
Leukemia	Associate	34857808
Leukemia Myeloid Acute	Associate	35880551
Lymphatic Metastasis	Associate	25412959
Melanoma	Associate	21300445, 32096167
Neoplasm Metastasis	Associate	35802537
Neoplasms	Stimulate	19509229
Neoplasms	Associate	22935614, 22965024, 28946546, 32264924, 35008511, 35802537, 36059474
Nevus Pigmented	Associate	21300445
Oculocutaneous albinism type 2	Associate	38238750
Osteosarcoma	Associate	28446751
Ovarian Neoplasms	Associate	25114896, 33290867, 38143770
Polycystic Ovary Syndrome	Inhibit	38238750
Prostatic Neoplasms Castration Resistant	Associate	30349055
Stomach Neoplasms	Associate	25412959
Telomeric 22q13 Monosomy Syndrome	Associate	38002941
Thyroid Cancer Papillary	Associate	24138990
Thyroid Neoplasms	Associate	24138990
Triple Negative Breast Neoplasms	Stimulate	35802537
Urinary Bladder Neoplasms	Associate	32264924
von Hippel Lindau Disease	Associate	21942715

RBX1 (ring-box 1)