Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9975
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 1 group D member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR1D2
Synonyms (NCBI Gene) Gene synonyms aliases
BD73, EAR-1R, REVERBB, REVERBbeta, RVR
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Al
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1358487339 C>T Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021292 hsa-miR-125a-5p Sequencing 20371350
MIRT021733 hsa-miR-132-3p Microarray 17612493
MIRT025595 hsa-miR-10a-5p Sequencing 20371350
MIRT037578 hsa-miR-744-5p CLASH 23622248
MIRT120695 hsa-miR-216a-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17892483, 17996965
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602304 7963 ENSG00000174738
Protein
UniProt ID Q14995
Protein name Nuclear receptor subfamily 1 group D member 2 (Orphan nuclear hormone receptor BD73) (Rev-erb alpha-related receptor) (RVR) (Rev-erb-beta) (V-erbA-related protein 1-related) (EAR-1R)
Protein function Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of th
PDB 2V0V , 2V7C , 3CQV , 4N73 , 6WMQ , 6WMS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 101 171 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 399 578 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Expression oscillates diurnally in the suprachiasmatic nucleus (SCN) of the hypothalamus as well as in peripheral tissues.
Sequence
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
ANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSR
DAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKS
SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI
MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVH
P
Sequence length 579
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Circadian rhythm   Nuclear Receptor transcription pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 22138541 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Atherosclerosis Associate 19243223
Breast Neoplasms Associate 24785096, 25023698, 26074263, 39193850
Carcinoma Small Cell Associate 33664492
Cardiomyopathy Restrictive Stimulate 35912794
Diabetes Mellitus Associate 19243223
Diabetes Mellitus Type 2 Associate 37904700
Disease Associate 38255844
Drug Related Side Effects and Adverse Reactions Associate 25023698
Inflammation Associate 19243223
Melanoma Associate 34783160