Gene Gene information from NCBI Gene database.
Entrez ID 9966
Gene name TNF superfamily member 15
Gene symbol TNFSF15
Synonyms (NCBI Gene)
TL1TL1ATNLG1BVEGIVEGI192A
Chromosome 9
Chromosome location 9q32
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducib
miRNA miRNA information provided by mirtarbase database.
544
miRTarBase ID miRNA Experiments Reference
MIRT029860 hsa-miR-26b-5p Microarray 19088304
MIRT676835 hsa-miR-3929 HITS-CLIP 23824327
MIRT676834 hsa-miR-4419b HITS-CLIP 23824327
MIRT676833 hsa-miR-4478 HITS-CLIP 23824327
MIRT676832 hsa-miR-128-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 9434163
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604052 11931 ENSG00000181634
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95150
Protein name Tumor necrosis factor ligand superfamily member 15 (TNF ligand-related molecule 1) (Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily memb
Protein function Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. {ECO:0000269|PubMed:10597252, ECO:0000269|PubMed:11911831, EC
PDB 2O0O , 2QE3 , 2RE9 , 2RJK , 2RJL , 3K51 , 3MI8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 117 251 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. {ECO:0000269|PubMed:11911831, ECO:0000269|PubMed:11923219, ECO:0
Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
Sequence length 251
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Leprosy, susceptibility to, 1 confers sensitivity; Uncertain risk allele rs6478108, rs10114470, rs4574921 RCV002291812
RCV002291813
RCV002291825
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 32481400
Anemia Sickle Cell Associate 19251437
Arthritis Rheumatoid Associate 25148371, 26956410, 31953914
Asthma Inhibit 34022066
Autoimmune Diseases Associate 23565196, 25148371, 28278297
Breast Neoplasms Associate 40666524
Carcinogenesis Associate 30736740
Carcinoma Hepatocellular Associate 37903974
Carcinoma Renal Cell Associate 35063404, 36429070
CD59 Deficiency Associate 27507062