Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9966
Gene name Gene Name - the full gene name approved by the HGNC.
TNF superfamily member 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFSF15
Synonyms (NCBI Gene) Gene synonyms aliases
TL1, TL1A, TNLG1B, VEGI, VEGI192A
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducib
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029860 hsa-miR-26b-5p Microarray 19088304
MIRT676835 hsa-miR-3929 HITS-CLIP 23824327
MIRT676834 hsa-miR-4419b HITS-CLIP 23824327
MIRT676833 hsa-miR-4478 HITS-CLIP 23824327
MIRT676832 hsa-miR-128-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 9434163
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604052 11931 ENSG00000181634
Protein
UniProt ID O95150
Protein name Tumor necrosis factor ligand superfamily member 15 (TNF ligand-related molecule 1) (Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily memb
Protein function Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. {ECO:0000269|PubMed:10597252, ECO:0000269|PubMed:11911831, EC
PDB 2O0O , 2QE3 , 2RE9 , 2RJK , 2RJL , 3K51 , 3MI8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 117 251 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. {ECO:0000269|PubMed:11911831, ECO:0000269|PubMed:11923219, ECO:0
Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
Sequence length 251
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Asthma N/A N/A GWAS
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Crohn Disease Crohn's disease or Leprosy (opposite effect), Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG), Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 32481400
Anemia Sickle Cell Associate 19251437
Arthritis Rheumatoid Associate 25148371, 26956410, 31953914
Asthma Inhibit 34022066
Autoimmune Diseases Associate 23565196, 25148371, 28278297
Breast Neoplasms Associate 40666524
Carcinogenesis Associate 30736740
Carcinoma Hepatocellular Associate 37903974
Carcinoma Renal Cell Associate 35063404, 36429070
CD59 Deficiency Associate 27507062