MVP (major vault protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9961
Gene name Major vault protein
Gene symbol MVP
Synonyms (NCBI Gene)
LRPVAULT1
Chromosome 16
Chromosome location 16p11.2
Summary This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MA
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT022129 hsa-miR-124-3p Microarray 18668037
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
STAT1 Activation 16418217
USF1 Unknown 24173679
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (29)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15133037, 16815308, 18809583, 32296183
GO:0005576 Component Extracellular region TAS
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 15133037, 16441665
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605088 7531 ENSG00000013364
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14764
Protein name Major vault protein (MVP) (Lung resistance-related protein)
Protein function Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1 sign
PDB 1Y7X , 9BW5 , 9BW6 , 9BW7 , 9MXH , 9MXV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17794 Vault_2 50 → 109 Major Vault Protein repeat domain Domain
PF01505 Vault 113 → 154 Major Vault Protein repeat domain Domain
PF01505 Vault 166 → 207 Major Vault Protein repeat domain Domain
PF01505 Vault 219 → 262 Major Vault Protein repeat domain Domain
PF17794 Vault_2 273 → 320 Major Vault Protein repeat domain Domain
PF01505 Vault 324 → 368 Major Vault Protein repeat domain Domain
PF17796 Vault_4 379 → 439 Major Vault Protein repeat domain Domain
PF17795 Vault_3 457 → 518 Major Vault Protein Repeat domain Domain
PF11978 MVP_shoulder 519 → 647 Shoulder domain Domain
Tissue specificity TISSUE SPECIFICITY: Present in most normal tissues. Higher expression observed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine. Over
Sequence 
MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCT
VANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTA
LHLKALLDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARK
ECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRG
VSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR
VVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIR
GPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELP
PGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARV
VFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQ
LAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR
TAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQL
AIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTG
TAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELE
VSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPIN
LFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR
Sequence length 893
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs35916172 RCV005910056
Clear cell carcinoma of kidney Benign rs35916172 RCV005910058
Hepatocellular carcinoma Benign rs35916172 RCV005910057
Thymoma Benign rs35916172 RCV005910059
Show/Hide Text Mining Associations (71)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 26632382, 28081737
Adenocarcinoma of Lung Associate 29204984
Adenoma Associate 10562814
Ascites Stimulate 23525731, 30313031
Brain Injuries Traumatic Associate 37641147
Brain Neoplasms Associate 20815915
Breast Neoplasms Associate 11305953, 11346468, 24997994, 30486550, 35982039, 9459150
Calcinosis Cutis Associate 17415755
Carcinogenesis Associate 10562814
Carcinoma Associate 35328603