Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	995
Gene name	Cell division cycle 25C
Gene symbol	CDC25C
Synonyms (NCBI Gene)	CDC25PPP1R60
Chromosome	5
Chromosome location	5q31.2
Summary	This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple al

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000751	hsa-miR-34a-5p	ReviewMicroarray	19461653
MIRT046939	hsa-miR-221-3p	CLASH	23622248
MIRT053101	hsa-miR-141-3p	Luciferase reporter assayWestern blot	23596351
MIRT053101	hsa-miR-141-3p	Luciferase reporter assayWestern blot	23596351
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT877222	hsa-miR-1252	CLIP-seq
MIRT877223	hsa-miR-1266	CLIP-seq
MIRT877224	hsa-miR-4261	CLIP-seq
MIRT877225	hsa-miR-4518	CLIP-seq
MIRT877226	hsa-miR-4716-3p	CLIP-seq
MIRT877227	hsa-miR-4757-5p	CLIP-seq
MIRT877228	hsa-miR-544	CLIP-seq
MIRT877229	hsa-miR-625	CLIP-seq
MIRT877230	hsa-miR-767-3p	CLIP-seq
MIRT877226	hsa-miR-4716-3p	CLIP-seq
MIRT2446655	hsa-miR-583	CLIP-seq
MIRT877229	hsa-miR-625	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
MYC	Activation	22446629
OTX2	Activation	21047732

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	11139144
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IGI	2195549
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	NAS	11078813
GO:0005515	Function	Protein binding	IPI	9543386, 11836499, 12941695, 15161933, 16330544, 17307877, 17349584, 19331823, 19470455, 19597481, 24255178, 27880917, 28330616, 33961781, 35271311, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	14968113
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	1828290
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	TAS	1828290
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IBA
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	14968113
GO:0050699	Function	WW domain binding	IPI	10037602
GO:0051301	Process	Cell division	IEA
GO:0110032	Process	Positive regulation of G2/MI transition of meiotic cell cycle	IBA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	9543386
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IEA

MIM	HGNC	e!Ensembl
157680	1727	ENSG00000158402

P30307

Protein name

M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)

Protein function

Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle (PubMed:8119945). When phosphorylated, highly effective in activating G2 cells into prophase (PubMed:8119945). Di

PDB

2OJX , 3BZI , 3OP3 , 5M35 , 5M36 , 5M37

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06617	M-inducer_phosp	191 → 271	M-phase inducer phosphatase	Family
PF00581	Rhodanese	308 → 422	Rhodanese-like domain	Domain

Sequence

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

Sequence length

473

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Progesterone-mediated oocyte maturation Human immunodeficiency virus 1 infection MicroRNAs in cancer		Polo-like kinase mediated events Activation of ATR in response to replication stress RHO GTPases activate PKNs TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Cyclin A/B1/B2 associated events during G2/M transition Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

CDC25C (cell division cycle 25C)