Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
995
Gene name Gene Name - the full gene name approved by the HGNC.
Cell division cycle 25C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDC25C
Synonyms (NCBI Gene) Gene synonyms aliases
CDC25, PPP1R60
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple al
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000751 hsa-miR-34a-5p Review, Microarray 19461653
MIRT046939 hsa-miR-221-3p CLASH 23622248
MIRT053101 hsa-miR-141-3p Luciferase reporter assay, Western blot 23596351
MIRT053101 hsa-miR-141-3p Luciferase reporter assay, Western blot 23596351
MIRT731272 hsa-miR-142-3p qRT-PCR 26805039
Transcription factors
Transcription factor Regulation Reference
MYC Activation 22446629
OTX2 Activation 21047732
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 11139144
GO:0000086 Process G2/M transition of mitotic cell cycle IBA
GO:0000086 Process G2/M transition of mitotic cell cycle IEA
GO:0000086 Process G2/M transition of mitotic cell cycle IGI 2195549
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
157680 1727 ENSG00000158402
Protein
UniProt ID P30307
Protein name M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)
Protein function Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle (PubMed:8119945). When phosphorylated, highly effective in activating G2 cells into prophase (PubMed:8119945). Di
PDB 2OJX , 3BZI , 3OP3 , 5M35 , 5M36 , 5M37
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06617 M-inducer_phosp 191 271 M-phase inducer phosphatase Family
PF00581 Rhodanese 308 422 Rhodanese-like domain Domain
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQ
MLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PE
YMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Sequence length 473
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Human immunodeficiency virus 1 infection
MicroRNAs in cancer
  Polo-like kinase mediated events
Activation of ATR in response to replication stress
RHO GTPases activate PKNs
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
Cyclin A/B1/B2 associated events during G2/M transition
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Sarcoidosis Sarcoidosis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 24859971, 31109596, 35783192, 36254009, 37537521
Ataxia Telangiectasia Associate 9889122
Breast Neoplasms Associate 20530684, 21607584, 22871320, 28335434, 31881805, 34275890, 34745136, 39300389
Carcinogenesis Associate 23229819
Carcinoma Hepatocellular Associate 24616922, 33111630, 34840632
Carcinoma Non Small Cell Lung Associate 28566436, 31109596
Carcinoma Squamous Cell Associate 20500813
Colonic Neoplasms Associate 36273131, 37626132
Colorectal Neoplasms Associate 11304565, 29794421, 35484177, 37762548
COVID 19 Associate 37426642