Gene Gene information from NCBI Gene database.
Entrez ID 9913
Gene name SPT7 like, STAGA complex subunit gamma
Gene symbol SUPT7L
Synonyms (NCBI Gene)
FZPSSPT7LSTAF65STAF65(gamma)STAF65GSUPT7H
Chromosome 2
Chromosome location 2p23.3
Summary SUPT7L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr
miRNA miRNA information provided by mirtarbase database.
520
miRTarBase ID miRNA Experiments Reference
MIRT021909 hsa-miR-128-3p Sequencing 20371350
MIRT031345 hsa-miR-18a-5p Sequencing 20371350
MIRT046328 hsa-miR-23b-3p CLASH 23622248
MIRT553886 hsa-miR-548at-5p PAR-CLIP 20371350
MIRT553885 hsa-miR-561-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000124 Component SAGA complex IDA 11564863
GO:0000124 Component SAGA complex IEA
GO:0000124 Component SAGA complex NAS 19114550
GO:0003713 Function Transcription coactivator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 11564863
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612762 30632 ENSG00000119760
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O94864
Protein name STAGA complex 65 subunit gamma (Adenocarcinoma antigen ART1) (SPTF-associated factor 65 gamma) (STAF65gamma) (Suppressor of Ty 7-like)
PDB 7KTR , 7KTS , 8H7G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07524 Bromo_TP 151 230 Bromodomain associated Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in adenocarcinomas and gliomas and low in esophageal cancers and malignant hematological disease. Also expressed at high level in the thymus, low in peripheral blood mononuclear cells, and lowest in the stomach
Sequence
MNLQRYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPC
SLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDC
KNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCRQLLYQAVATILAHAGFDCANESVLE
TLTDVAHEYCLKFTKLLRFAVDREARLGQTPFPDVMEQVFHEVGIGSVLS
LQKFWQHRIK
DYHSYMLQISKQLSEEYERIVNPEKATEDAKPVKIKEEPVSDITFPVSEELEADLASGDQ
SLPMGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESEEGNVSGHGVL
GSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCKKRMRKI
Sequence length 414
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIPODYSTROPHY Disgenet, GenCC
Disgenet, GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Cutis Laxa Autosomal Recessive Type IIB Associate 38592547
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Associate 38592547
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Associate 32375686
★☆☆☆☆
Found in Text Mining only
Fetal Growth Retardation Associate 38592547
★☆☆☆☆
Found in Text Mining only
Leukemia Lymphoma Adult T Cell Associate 29794791
★☆☆☆☆
Found in Text Mining only
Lipodystrophy Congenital Generalized Associate 38592547
★☆☆☆☆
Found in Text Mining only
Lymphoma T Cell Cutaneous Associate 29794791
★☆☆☆☆
Found in Text Mining only
Mycosis Fungoides Associate 29794791
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 29794791
★☆☆☆☆
Found in Text Mining only
Progeroid syndrome neonatal Associate 38592547
★☆☆☆☆
Found in Text Mining only