Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	991
Gene name Gene Name - the full gene name approved by the HGNC.	Cell division cycle 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDC20
Synonyms (NCBI Gene) Gene synonyms aliases	CDC20A, OOMD14, OZEMA14, bA276H19.3, p55CDC
Disease Acronyms (UniProt) Disease acronyms from UniProt database	OZEMA14
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.2
Summary Summary of gene provided in NCBI Entrez Gene.	CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016385	hsa-miR-193b-3p	Microarray	20304954
MIRT024643	hsa-miR-215-5p	Microarray	19074876
MIRT025414	hsa-miR-34a-5p	Proteomics	21566225
MIRT026319	hsa-miR-192-5p	Microarray	19074876
MIRT028518	hsa-miR-30a-5p	Proteomics	18668040
MIRT031615	hsa-miR-16-5p	Proteomics	18668040
MIRT050708	hsa-miR-18a-5p	CLASH	23622248
MIRT049389	hsa-miR-92a-3p	CLASH	23622248
MIRT025414	hsa-miR-34a-5p	CLASH	23622248
MIRT046369	hsa-miR-23b-3p	CLASH	23622248
MIRT044902	hsa-miR-188-5p	CLASH	23622248
MIRT038870	hsa-miR-93-3p	CLASH	23622248
MIRT036567	hsa-miR-941	CLASH	23622248
MIRT876880	hsa-miR-3940-5p	CLIP-seq
MIRT876881	hsa-miR-4507	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
PHF8	Unknown	23979597
YBX1	Repression	20596676

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	11030144, 11459826, 11988738, 14743218, 15182668, 15525512, 16525508, 17443180, 17443186, 17719540, 18022367, 18318601, 18794143, 19143472, 19282672, 19407811, 20212161, 20360068, 20951947, 21041666, 21300909, 21407176, 21725316, 21772247, 22000412, 22014574, 22322943, 22340593, 232
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IDA	11459825
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	TAS	7513050
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007064	Process	Mitotic sister chromatid cohesion	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0008022	Function	Protein C-terminus binding	IPI	10700282
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010997	Function	Anaphase-promoting complex binding	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019899	Function	Enzyme binding	IPI	17443180
GO:0030154	Process	Cell differentiation	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA	21873635
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	17443180
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031915	Process	Positive regulation of synaptic plasticity	ISS
GO:0040020	Process	Regulation of meiotic nuclear division	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050773	Process	Regulation of dendrite development	IEA
GO:0051301	Process	Cell division	IEA
GO:0090129	Process	Positive regulation of synapse maturation	ISS
GO:0090307	Process	Mitotic spindle assembly	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	IDA	11459826
GO:1905786	Process	Positive regulation of anaphase-promoting complex-dependent catabolic process	IBA	21873635
GO:1990757	Function	Ubiquitin ligase activator activity	IBA	21873635

MIM	HGNC	e!Ensembl
603618	1723	ENSG00000117399

Protein

UniProt ID

Q12834

Protein name

Cell division cycle protein 20 homolog (p55CDC)

Protein function

Substrate-specific adapter of the anaphase promoting complex/cyclosome (APC/C) complex that confers substrate specificity by binding to substrates and targeting them to the APC/C complex for ubiquitination and degradation (PubMed:9734353, PubMed

PDB

4GGA , 4GGC , 4GGD , 4N14 , 5G04 , 5KHR , 5KHU , 5LCW , 6F0X , 6Q6G , 6Q6H , 9I68 , 9I69 , 9I6A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12894	ANAPC4_WD40	218 → 279	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
PF00400	WD40	299 → 336	WD domain, G-beta repeat	Repeat
PF00400	WD40	345 → 386	WD domain, G-beta repeat	Repeat
PF00400	WD40	390 → 429	WD domain, G-beta repeat	Repeat
PF00400	WD40	433 → 471	WD domain, G-beta repeat	Repeat

Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR

Sequence length

499

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Human T-cell leukemia virus 1 infection Viral carcinogenesis		Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components Inactivation of APC/C via direct inhibition of the APC/C complex Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal APC/C:Cdc20 mediated degradation of Cyclin B SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of Emi1 APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Ub-specific processing proteases Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lymphoblastic leukemia	Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	27114598

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Oocyte Maturation Defect	oocyte maturation defect 14			GenCC

Show/Hide Text Mining Associations (92)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	31093306
Adenocarcinoma	Associate	33120770
Adenocarcinoma of Lung	Associate	27610375, 28349831, 30588191, 32121037, 32221746, 33120770, 33126397, 34039308, 35354488
Adrenocortical Carcinoma	Associate	37535572
Aging Premature	Associate	33094908
Aneuploidy	Associate	20034488, 33094908
Arthritis Rheumatoid	Associate	32840301
Ataxia Telangiectasia	Associate	35782055
Breast Neoplasms	Associate	24853182, 29183848, 32053082, 32285914, 33285689, 33499770, 34686627, 35456460, 35616161, 36123926
Breast Neoplasms	Stimulate	31280346, 32479088, 34459389, 34895070
Carcinogenesis	Associate	21338529, 24871945, 26245990, 26626260, 27780719, 28901457, 28980876, 35782055
Carcinoma	Associate	33094908
Carcinoma Basal Cell	Associate	32382535
Carcinoma Hepatocellular	Associate	27623074, 28901457, 29728556, 30363964, 30631005, 30720105, 31737652, 31811111, 32082966, 32627011, 32722976, 33157984, 33750838, 33907851, 34315286 View all (13 more)
Carcinoma Hepatocellular	Stimulate	33788826, 35402624
Carcinoma Non Small Cell Lung	Associate	31775549, 31805030, 32059076, 33126319, 34825846, 35050556
Carcinoma Pancreatic Ductal	Associate	22475564, 30765611
Carcinoma Renal Cell	Associate	26061684, 26626260, 28260099, 31422942, 36385010, 40256740
Carcinoma Renal Cell	Stimulate	35800227
Carcinoma Squamous Cell	Associate	30816486
Carcinosarcoma	Associate	36186000
Cerebral Infarction	Associate	35485294
Cholangiocarcinoma	Associate	33725402
Chromosomal Instability	Associate	32066746
Chromosome Disorders	Associate	33094908
Colonic Diseases	Associate	26245990
Colorectal Neoplasms	Associate	24966994, 32127012, 32453965, 32932732
COVID 19	Associate	33839760, 36856850
Diabetes Gestational	Associate	30474315
Diabetes Mellitus Type 1	Associate	24595351
Dissection Thoracic Aorta	Associate	31380418
Drug Related Side Effects and Adverse Reactions	Associate	18630511
Drug Related Side Effects and Adverse Reactions	Inhibit	35988589
Endometrial Neoplasms	Associate	31289358, 36186000
Esophageal Neoplasms	Associate	32443386, 34232175
Esophageal Squamous Cell Carcinoma	Associate	34232175, 34517565
Fibrosis	Associate	31811111
Gamma A Globulin Defect in Assembly of	Associate	33094908
Glioblastoma	Associate	29901201, 32696617, 36792756
Glioma	Associate	22022424, 27626499, 29108461, 32696617, 33892537, 34753395, 35774141
Glucosephosphate Dehydrogenase Deficiency	Associate	31289358
Glycosuria Renal	Associate	26245990
Hepatitis B	Associate	33102593
HTLV I Infections	Associate	35622386
Hypomagnesemia primary	Associate	23405241
Hypoxia	Associate	32479088
Infertility Female	Associate	39862142
Leiomyosarcoma	Associate	25748237
Leukemia Lymphoma Adult T Cell	Associate	15623561, 24871945
Leukemia Myeloid Acute	Associate	30480765, 32066746
Liver Failure	Stimulate	26245990
Lung Neoplasms	Associate	39331864
Lymphatic Metastasis	Associate	33788826
Lymphoma Large B Cell Diffuse	Associate	30393234, 31089208
Lymphoma Mantle Cell	Associate	31089208
Melanoma	Associate	35988589, 38030698
Mesothelioma Malignant	Associate	33032291
Mosaic variegated aneuploidy syndrome	Associate	15623561, 33094908
Multiple Myeloma	Associate	26716651, 27655696
Neoplasm Metastasis	Associate	34459389
Neoplasms	Associate	18630511, 19273532, 20034488, 24074379, 24551295, 24553122, 24871945, 24922075, 24966994, 26245990, 26626260, 27626499, 28165402, 28349831, 28617439 View all (15 more)
Neoplasms	Stimulate	21338529, 32479088, 34753395
Neoplasms	Inhibit	32066746, 35988589
Neuroectodermal Tumors Primitive	Associate	36524840
Osteosarcoma	Associate	33411691
Ovarian Diseases	Associate	26245990, 36186000
Ovarian Neoplasms	Associate	30678426, 31987036, 32693821, 34253236, 34266348
Pancreatic Neoplasms	Associate	18630511, 28165402, 29489909
Precancerous Conditions	Associate	33019382
Prostatic Neoplasms	Associate	26889981, 27780719, 34198380, 34497666, 36601001, 36901944, 37682152, 39201599
Prostatitis	Associate	26245990
Psoriasis	Associate	36497125
Sarcoma Ewing	Associate	35126643
Sertoli Cell Only Syndrome	Associate	37500704
Sleep Apnea Obstructive	Associate	35132330
Small Cell Lung Carcinoma	Associate	29845250
Small Cell Lung Carcinoma	Stimulate	33186389
Spinal Cord Injuries	Associate	31783707
Squamous Cell Carcinoma of Head and Neck	Associate	36820589
Stomach Diseases	Associate	26245990
Stomach Neoplasms	Associate	31616144, 33446695, 34358419
Tertiary Lymphoid Structures	Associate	31280346
Thyroid Cancer Papillary	Associate	35838025
Thyroid Carcinoma Anaplastic	Associate	30213925, 31183379, 33025856, 33455115
Tissue Adhesions	Associate	34968168
Triple Negative Breast Neoplasms	Associate	24853182, 34686627
Urinary Bladder Diseases	Stimulate	26245990
Urinary Bladder Neoplasms	Associate	21483740, 32047816, 32677673, 34589136, 36820589
Uterine Cervical Neoplasms	Associate	23405241
Uterine Cervicitis	Associate	26245990
Uterine Diseases	Associate	26245990
Virus Diseases	Associate	35622386

CDC20 (cell division cycle 20)