Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9896
Gene name Gene Name - the full gene name approved by the HGNC.
FIG4 phosphoinositide 5-phosphatase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FIG4
Synonyms (NCBI Gene) Gene synonyms aliases
ALS11, BOP, BTOP, CMT4J, KIAA0274, SAC3, YVS, dJ249I4.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. T
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908287 T>C Conflicting-interpretations-of-pathogenicity, pathogenic Missense variant, 5 prime UTR variant, coding sequence variant
rs121908288 C>A,T Pathogenic 5 prime UTR variant, stop gained, coding sequence variant, synonymous variant
rs121908290 G>T Pathogenic Missense variant, 5 prime UTR variant, coding sequence variant
rs142482745 C>G,T Benign-likely-benign, conflicting-interpretations-of-pathogenicity, likely-benign Genic downstream transcript variant, intron variant, downstream transcript variant
rs150301327 A>G Uncertain-significance, likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019027 hsa-miR-335-5p Microarray 18185580
MIRT024087 hsa-miR-1-3p Microarray 18668037
MIRT030214 hsa-miR-26b-5p Microarray 19088304
MIRT715164 hsa-miR-545-3p HITS-CLIP 19536157
MIRT715163 hsa-miR-1284 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0004438 Function Phosphatidylinositol-3-phosphate phosphatase activity IEA
GO:0004439 Function Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
GO:0005515 Function Protein binding IPI 17556371, 19037259, 28514442, 32296183, 33961781, 35271311
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609390 16873 ENSG00000112367
Protein
UniProt ID Q92562
Protein name Polyphosphoinositide phosphatase (EC 3.1.3.-) (EC 3.1.3.36) (EC 3.1.3.86) (Phosphatidylinositol 3,5-bisphosphate 5-phosphatase) (SAC domain-containing protein 3) (Serine-protein phosphatase FIG4) (EC 3.1.3.16)
Protein function Dual specificity phosphatase component of the PI(3,5)P2 regulatory complex which regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) (PubMed:17556371, PubMed:33098764). Catalyzes the dephosphorylati
PDB 7K1W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02383 Syja_N 93 423 SacI homology domain Family
Sequence
MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQ
QEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIG
GHAIYKVEDTNMIYIPNDSVRVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT
VLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELLDIIKS
TVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVE
TEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALH
FDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAK
YTK
SKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTG
ILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDT
LSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHP
TEGKPHLWELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLI
VKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDE
TGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVK
MTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCS
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE
YIRNRYL
Sequence length 907
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Inositol phosphate metabolism
Metabolic pathways
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
  Synthesis of PIPs at the Golgi membrane
Synthesis of PIPs at the early endosome membrane
Synthesis of PIPs at the late endosome membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis type 11, amyotrophic lateral sclerosis rs1583695322, rs764717219, rs121908288, rs121908287, rs753207473, rs879253926 N/A
Bilateral Parasagittal Parieto-Occipital Polymicrogyria bilateral parasagittal parieto-occipital polymicrogyria rs786200937, rs587777715, rs121908287 N/A
Charcot-Marie-Tooth Disease charcot-marie-tooth disease type 4j, charcot-marie-tooth disease type 4, Charcot-Marie-Tooth Disease rs774294963, rs1197741113, rs747768373, rs776005417, rs1562648373, rs1488999396, rs1554300952, rs786200937, rs764717219, rs1554303800, rs1191997383, rs770043095, rs1583695322, rs750712213, rs1562648414
View all (17 more)
N/A
Yunis Varon Syndrome yunis-varon syndrome rs786200937, rs1562648373, rs750712213, rs745790694, rs121908287, rs587777715 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
cerebral hypomyelination Cerebral hypomyelination N/A N/A ClinVar
Diabetes Type 2 diabetes N/A N/A GWAS
Distal Hereditary Motor Neuronopathy Neuronopathy, distal hereditary motor, autosomal dominant N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acid Phosphatase Deficiency Inhibit 31313076
Alzheimer Disease Associate 26216398
Amyotrophic Lateral Sclerosis Associate 19118816, 23755159, 28051077, 37950760
Androgen Insensitivity Syndrome Associate 33405357
Arthritis Associate 33926255
Carcinoma Renal Cell Associate 27856290
Central Nervous System Diseases Associate 30740813
Charcot Marie Tooth Disease Associate 21705420, 24878229, 37950760
Charcot Marie Tooth disease Type 1C Associate 32022442
Charcot Marie Tooth disease Type 2B Associate 37133535