Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
988
Gene name Gene Name - the full gene name approved by the HGNC.
Cell division cycle 5 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDC5L
Synonyms (NCBI Gene) Gene synonyms aliases
CDC5, CDC5-LIKE, CEF1, PCDC5RP, dJ319D22.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cyc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025505 hsa-miR-34a-5p Proteomics 21566225
MIRT025505 hsa-miR-34a-5p Proteomics 21566225
MIRT031890 hsa-miR-16-5p Proteomics 18668040
MIRT051492 hsa-let-7e-5p CLASH 23622248
MIRT041014 hsa-miR-505-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000077 Process DNA damage checkpoint signaling IMP 24332808
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0000398 Process MRNA splicing, via spliceosome IDA 28076346
GO:0000398 Process MRNA splicing, via spliceosome IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602868 1743 ENSG00000096401
Protein
UniProt ID Q99459
Protein name Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)
Protein function DNA-binding protein involved in cell cycle control. May act as a transcription activator. Plays a role in pre-mRNA splicing as core component of precatalytic, catalytic and postcatalytic spliceosomal complexes (PubMed:11991638, PubMed:20176811,
PDB 2DIM , 2DIN , 5MQF , 5XJC , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6FF4 , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6ZYM , 7A5P , 7AAV , 7ABG , 7ABH , 7ABI , 7DVQ , 7QTT , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8I0P , 8I0R , 8I0S , 8I0T , 8I0U , 8I0V , 8I0W , 8RO2 , 9FMD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13921 Myb_DNA-bind_6 11 71 Domain
PF11831 Myb_Cef 404 655 pre-mRNA splicing factor component Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed in both fetal and adult tissues. {ECO:0000269|PubMed:9038199, ECO:0000269|PubMed:9598309, ECO:0000269|PubMed:9632794}.
Sequence
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKL
LHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSE
AYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF
Sequence length 802
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome   mRNA Splicing - Major Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Congenital anomalies of kidney and urinary tract Congenital anomaly of kidney and urinary tract N/A N/A ClinVar
Glaucoma Glaucoma N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 19633697
Cakut Associate 24429398
Carcinoma Hepatocellular Associate 28387715, 32955083
Carcinoma Non Small Cell Lung Associate 37658700
Carcinoma Renal Cell Associate 27144525
Colorectal Neoplasms Associate 38376276
Diabetes Mellitus Associate 36978091
Diabetic Nephropathies Associate 36978091
Glioma Associate 26490980
Glycosuria Renal Associate 36978091