Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9863
Gene name	Membrane associated guanylate kinase, WW and PDZ domain containing 2
Gene symbol	MAGI2
Synonyms (NCBI Gene)	ACVRIP1AIP-1AIP1ARIP1MAGI-2NPHS15SSCAM
Chromosome	7
Chromosome location	7q21.11
Summary	The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate ki

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs144078604	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs144574076	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs148580718	G>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs587780386	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs1135402911	C>-	Pathogenic	Downstream transcript variant, genic downstream transcript variant, coding sequence variant, frameshift variant
rs1135402913	->GCCAGTCT	Pathogenic	Coding sequence variant, frameshift variant

149

Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438178	hsa-miR-134-5p	5.0	24258346
MIRT438178	hsa-miR-134-5p	5.0	24258346
MIRT438177	hsa-miR-487b-3p	5.0	24258346
MIRT438176	hsa-miR-655-3p	5.0	24258346
MIRT438178	hsa-miR-134-5p	5.0	24258346
MIRT438178	hsa-miR-134-5p	5.0	24258346
MIRT438177	hsa-miR-487b-3p	5.0	24258346
MIRT438176	hsa-miR-655-3p	5.0	24258346
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT527013	hsa-miR-5690	PAR-CLIP	20371350
MIRT527014	hsa-miR-4660	PAR-CLIP	20371350
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT527010	hsa-miR-5047	PAR-CLIP	20371350
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT527013	hsa-miR-5690	PAR-CLIP	20371350
MIRT527014	hsa-miR-4660	PAR-CLIP	20371350
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT527010	hsa-miR-5047	PAR-CLIP	20371350
MIRT570938	hsa-miR-3912-5p	PAR-CLIP	20371350
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	22012620
MIRT527013	hsa-miR-5690	PAR-CLIP	22012620
MIRT527014	hsa-miR-4660	PAR-CLIP	22012620
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	22012620
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	22012620
MIRT527010	hsa-miR-5047	PAR-CLIP	22012620
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT527013	hsa-miR-5690	PAR-CLIP	20371350
MIRT527014	hsa-miR-4660	PAR-CLIP	20371350
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT527010	hsa-miR-5047	PAR-CLIP	20371350
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT527013	hsa-miR-5690	PAR-CLIP	20371350
MIRT527014	hsa-miR-4660	PAR-CLIP	20371350
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT527010	hsa-miR-5047	PAR-CLIP	20371350
MIRT570938	hsa-miR-3912-5p	PAR-CLIP	20371350
MIRT527015	hsa-miR-4704-5p	PAR-CLIP	22012620
MIRT527013	hsa-miR-5690	PAR-CLIP	22012620
MIRT527014	hsa-miR-4660	PAR-CLIP	22012620
MIRT527012	hsa-miR-3944-5p	PAR-CLIP	22012620
MIRT527011	hsa-miR-1301-3p	PAR-CLIP	22012620
MIRT527010	hsa-miR-5047	PAR-CLIP	22012620
MIRT1125921	hsa-miR-101	CLIP-seq
MIRT1125922	hsa-miR-106a	CLIP-seq
MIRT1125923	hsa-miR-106b	CLIP-seq
MIRT1125924	hsa-miR-130a	CLIP-seq
MIRT1125925	hsa-miR-130b	CLIP-seq
MIRT1125926	hsa-miR-140-5p	CLIP-seq
MIRT1125927	hsa-miR-144	CLIP-seq
MIRT1125928	hsa-miR-17	CLIP-seq
MIRT1125929	hsa-miR-19a	CLIP-seq
MIRT1125930	hsa-miR-19b	CLIP-seq
MIRT1125931	hsa-miR-20a	CLIP-seq
MIRT1125932	hsa-miR-20b	CLIP-seq
MIRT1125933	hsa-miR-216a	CLIP-seq
MIRT1125934	hsa-miR-216b	CLIP-seq
MIRT1125935	hsa-miR-301a	CLIP-seq
MIRT1125936	hsa-miR-301b	CLIP-seq
MIRT1125937	hsa-miR-30a	CLIP-seq
MIRT1125938	hsa-miR-30b	CLIP-seq
MIRT1125939	hsa-miR-30c	CLIP-seq
MIRT1125940	hsa-miR-30d	CLIP-seq
MIRT1125941	hsa-miR-30e	CLIP-seq
MIRT1125942	hsa-miR-3194-3p	CLIP-seq
MIRT1125943	hsa-miR-3545-5p	CLIP-seq
MIRT1125944	hsa-miR-3607-3p	CLIP-seq
MIRT1125945	hsa-miR-3646	CLIP-seq
MIRT1125946	hsa-miR-3666	CLIP-seq
MIRT1125947	hsa-miR-3686	CLIP-seq
MIRT1125948	hsa-miR-3973	CLIP-seq
MIRT1125949	hsa-miR-4295	CLIP-seq
MIRT1125950	hsa-miR-4460	CLIP-seq
MIRT1125951	hsa-miR-454	CLIP-seq
MIRT1125952	hsa-miR-4652-3p	CLIP-seq
MIRT1125953	hsa-miR-4775	CLIP-seq
MIRT1125954	hsa-miR-485-3p	CLIP-seq
MIRT1125955	hsa-miR-487a	CLIP-seq
MIRT1125956	hsa-miR-490-5p	CLIP-seq
MIRT1125957	hsa-miR-519a	CLIP-seq
MIRT1125958	hsa-miR-519b-3p	CLIP-seq
MIRT1125959	hsa-miR-519c-3p	CLIP-seq
MIRT1125960	hsa-miR-519d	CLIP-seq
MIRT1125961	hsa-miR-520g	CLIP-seq
MIRT1125962	hsa-miR-520h	CLIP-seq
MIRT1125963	hsa-miR-548n	CLIP-seq
MIRT1125964	hsa-miR-548t	CLIP-seq
MIRT1125965	hsa-miR-93	CLIP-seq
MIRT2035572	hsa-miR-1321	CLIP-seq
MIRT2035573	hsa-miR-1915	CLIP-seq
MIRT2035574	hsa-miR-205	CLIP-seq
MIRT2035575	hsa-miR-412	CLIP-seq
MIRT2035576	hsa-miR-4270	CLIP-seq
MIRT2035577	hsa-miR-4441	CLIP-seq
MIRT2035578	hsa-miR-4677-3p	CLIP-seq
MIRT2035579	hsa-miR-4679	CLIP-seq
MIRT2035580	hsa-miR-4739	CLIP-seq
MIRT2035581	hsa-miR-4756-5p	CLIP-seq
MIRT2035582	hsa-miR-548aa	CLIP-seq
MIRT2266065	hsa-miR-3688-3p	CLIP-seq
MIRT2453615	hsa-miR-2113	CLIP-seq
MIRT2453616	hsa-miR-218	CLIP-seq
MIRT2453617	hsa-miR-3140-3p	CLIP-seq
MIRT2453618	hsa-miR-636	CLIP-seq
MIRT2565333	hsa-miR-1	CLIP-seq
MIRT2565334	hsa-miR-1246	CLIP-seq
MIRT2565335	hsa-miR-1262	CLIP-seq
MIRT2565336	hsa-miR-141	CLIP-seq
MIRT2565337	hsa-miR-154	CLIP-seq
MIRT2565338	hsa-miR-200a	CLIP-seq
MIRT2565339	hsa-miR-206	CLIP-seq
MIRT2565340	hsa-miR-2392	CLIP-seq
MIRT2565341	hsa-miR-27a	CLIP-seq
MIRT2565342	hsa-miR-27b	CLIP-seq
MIRT2565343	hsa-miR-3134	CLIP-seq
MIRT2565344	hsa-miR-3591-3p	CLIP-seq
MIRT2565345	hsa-miR-3605-5p	CLIP-seq
MIRT2565346	hsa-miR-3673	CLIP-seq
MIRT2266065	hsa-miR-3688-3p	CLIP-seq
MIRT2035575	hsa-miR-412	CLIP-seq
MIRT2565347	hsa-miR-4261	CLIP-seq
MIRT2565348	hsa-miR-4480	CLIP-seq
MIRT2565349	hsa-miR-4701-3p	CLIP-seq
MIRT2565350	hsa-miR-4719	CLIP-seq
MIRT2565351	hsa-miR-4731-3p	CLIP-seq
MIRT2565352	hsa-miR-4760-5p	CLIP-seq
MIRT2565353	hsa-miR-4792	CLIP-seq
MIRT2565354	hsa-miR-4795-3p	CLIP-seq
MIRT2565355	hsa-miR-4801	CLIP-seq
MIRT2565356	hsa-miR-494	CLIP-seq
MIRT2565357	hsa-miR-513a-5p	CLIP-seq
MIRT2565358	hsa-miR-613	CLIP-seq
MIRT2565359	hsa-miR-626	CLIP-seq
MIRT2565360	hsa-miR-656	CLIP-seq
MIRT2565361	hsa-miR-887	CLIP-seq
MIRT2565333	hsa-miR-1	CLIP-seq
MIRT2565336	hsa-miR-141	CLIP-seq
MIRT2565338	hsa-miR-200a	CLIP-seq
MIRT2565339	hsa-miR-206	CLIP-seq
MIRT2565346	hsa-miR-3673	CLIP-seq
MIRT2565350	hsa-miR-4719	CLIP-seq
MIRT2565351	hsa-miR-4731-3p	CLIP-seq
MIRT2565354	hsa-miR-4795-3p	CLIP-seq
MIRT2565355	hsa-miR-4801	CLIP-seq
MIRT2565358	hsa-miR-613	CLIP-seq
MIRT2565360	hsa-miR-656	CLIP-seq

Show/Hide all (59)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001750	Component	Photoreceptor outer segment	ISS
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0001917	Component	Photoreceptor inner segment	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IDA	11526121
GO:0005515	Function	Protein binding	IPI	9647693, 10548487, 16316992, 16533813, 32296183
GO:0005634	Component	Nucleus	IDA	10760291
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11526121
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005814	Component	Centriole	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	10760291, 11526121
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	10760291
GO:0005929	Component	Cilium	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0019902	Function	Phosphatase binding	IPI	10760291
GO:0030159	Function	Signaling receptor complex adaptor activity	IBA
GO:0030159	Function	Signaling receptor complex adaptor activity	IDA	11526121
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	ISS
GO:0031697	Function	Beta-1 adrenergic receptor binding	IBA
GO:0031697	Function	Beta-1 adrenergic receptor binding	IPI	11526121
GO:0032926	Process	Negative regulation of activin receptor signaling pathway	ISS
GO:0032991	Component	Protein-containing complex	ISS
GO:0036057	Component	Slit diaphragm	ISS
GO:0038180	Process	Nerve growth factor signaling pathway	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043113	Process	Receptor clustering	IBA
GO:0043113	Process	Receptor clustering	ISS
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0046332	Function	SMAD binding	IBA
GO:0046332	Function	SMAD binding	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	10760291
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	20534871
GO:0060395	Process	SMAD protein signal transduction	ISS
GO:0070699	Function	Type II activin receptor binding	IBA
GO:0070699	Function	Type II activin receptor binding	ISS
GO:0072015	Process	Podocyte development	ISS
GO:0072583	Process	Clathrin-dependent endocytosis	ISS
GO:0097546	Component	Ciliary base	ISS
GO:1990090	Process	Cellular response to nerve growth factor stimulus	ISS

MIM	HGNC	e!Ensembl
606382	18957	ENSG00000187391

Q86UL8

Protein name

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Atrophin-1-interacting protein 1) (AIP-1) (Atrophin-1-interacting protein A) (Membrane-associated guanylate kinase inverted 2) (MAGI-2)

Protein function

Seems to act as a scaffold molecule at synaptic junctions by assembling neurotransmitter receptors and cell adhesion proteins (By similarity). Plays a role in nerve growth factor (NGF)-induced recruitment of RAPGEF2 to late endosomes and neurite

PDB

1UEP , 1UEQ , 1UEW , 1UJV , 1WFV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	17 → 98	PDZ domain	Domain
PF00625	Guanylate_kin	120 → 191	Guanylate kinase	Domain
PF16663	MAGI_u1	198 → 259		Disordered
PF00397	WW	304 → 333	WW domain	Domain
PF00595	PDZ	426 → 506	PDZ domain	Domain
PF00595	PDZ	605 → 679	PDZ domain	Domain
PF00595	PDZ	778 → 859	PDZ domain	Domain
PF00595	PDZ	920 → 1007	PDZ domain	Domain
PF00595	PDZ	1147 → 1226	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in brain. {ECO:0000269|PubMed:9647693}.

Sequence

MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR

Sequence length

1455

Interactions

View interactions

	KEGG
	Rap1 signaling pathway PI3K-Akt signaling pathway

110

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nephrotic syndrome 15	Likely pathogenic; Pathogenic	rs2129210679, rs1135402911, rs1135402912, rs1135402913	RCV002244173 RCV000497254 RCV000497252 RCV000497253

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Adrenocortical carcinoma, hereditary	Benign	rs7812015	RCV005889120
Cholangiocarcinoma	Benign	rs73144681	RCV005916994
Familial pancreatic carcinoma	Benign; Likely benign	rs75675313	RCV005922902
Lung cancer	Benign	rs149573681	RCV005889119
MAGI2-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs146012909, rs576579796, rs148240352, rs145722885, rs73703715, rs111635934, rs532013108, rs192861558, rs569789697, rs144574076, rs148580718, rs145648453, rs140651421, rs776408241, rs988557174 View all (19 more)	RCV003974977 RCV003952571 RCV003952572 RCV003905121 RCV003905122 RCV003952573 RCV003906466 RCV003936532 RCV003963609 RCV003947472 RCV003917619 RCV003920054 RCV003920085 RCV003405984 RCV003421160 RCV003399568 RCV003946726 RCV003939093 RCV003956470 RCV003966593 RCV003909114 RCV003939161 RCV003896723 RCV003894076 RCV003904663 RCV003901969 RCV003952072 RCV003937376 RCV003961709 RCV003962135 RCV003976724 RCV003927909 RCV004745497 RCV003895454
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	rs188293910	RCV005889858
Prostate cancer	Uncertain significance	rs193920987	RCV000149197
Schizophrenia	Uncertain significance	rs1554460532	RCV002463547
Thymoma	Benign	rs145253464	RCV005927002
Uterine carcinosarcoma	Benign	rs73144681	RCV005916993

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	19668339
Asthma	Associate	31924195
Breast Neoplasms	Associate	27019625, 31081100, 32143617, 32672418
Breast Neoplasms	Inhibit	30883342
Carcinoma Hepatocellular	Inhibit	32546442
Carcinoma Hepatocellular	Associate	36359865, 36852700
Carcinoma Non Small Cell Lung	Inhibit	31539127, 32138716
Carcinoma Ovarian Epithelial	Associate	39519394
Carcinoma Squamous Cell	Associate	36139456
Celiac Disease	Associate	24386489
Cognition Disorders	Associate	22649501
Colitis Ulcerative	Associate	18720471
Colonic Neoplasms	Associate	32727450
Colorectal Neoplasms	Associate	32533587
Crohn Disease	Associate	18720471
Dementia	Associate	35299244
Dental Caries	Associate	15869869
Depressive Disorder	Associate	35052345
Dermatitis Allergic Contact	Inhibit	31783056
Diabetes Mellitus Type 2	Associate	23552671, 36528847
Diabetic Nephropathies	Associate	34087849
Endometrial Neoplasms	Associate	29185275
Epilepsy	Associate	18565486, 31056551
Fibrocartilaginous embolism	Associate	32143617, 37102649
Glioma	Associate	31081100
Inflammation	Associate	34087849
Inflammation	Inhibit	37102649
Inflammatory Bowel Diseases	Associate	18720471, 24386489, 28545409
Intervertebral Disc Degeneration	Inhibit	32143617
Intervertebral Disc Degeneration	Associate	37102649
Lung Neoplasms	Associate	36852700, 37154150
Lymphatic Metastasis	Inhibit	31539127, 36852700
Lymphoma Non Hodgkin	Associate	32581010
Melanoma Cutaneous Malignant	Associate	34375487
Multiple Myeloma	Associate	33579893
Myoclonic Epilepsies Progressive	Associate	32174258
Neoplasm Metastasis	Inhibit	31539127
Neoplasm Metastasis	Associate	36852700
Neoplasms	Associate	10760291, 21307934, 31199602, 32533587
Neoplasms	Inhibit	31539127, 32681706, 35043728
Nephrosis congenital	Associate	27932480
Nerve Degeneration	Associate	19668339
Ovarian Neoplasms	Associate	29185275
Ovarian Neoplasms	Inhibit	32581010, 32681706
Pancreatic Neoplasms	Associate	35043728
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32174258
Prostatic Neoplasms	Associate	21307934, 32953881
Prostatitis	Associate	21307934
Schizophrenia	Associate	22649501, 30184473, 35052345
Seizures	Associate	32077592
Small Cell Lung Carcinoma	Associate	31199602
Spasms Infantile	Associate	18565486, 21880993, 32077592
Squamous Cell Carcinoma of Head and Neck	Inhibit	36852700
Stomach Neoplasms	Associate	33530176, 37457685
Urinary Bladder Neoplasms	Associate	30170380, 31081100, 33231563
Uterine Cervical Neoplasms	Inhibit	35126958
Williams Syndrome	Stimulate	32077592
Wounds and Injuries	Inhibit	37102649
X Linked Combined Immunodeficiency Diseases	Associate	32174258

MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2)