Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9855
Gene name	FERM, ARH/RhoGEF and pleckstrin domain protein 2
Gene symbol	FARP2
Synonyms (NCBI Gene)	FIRFRGPLEKHC3
Chromosome	2
Chromosome location	2q37.3

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT989450	hsa-miR-1225-5p	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT989453	hsa-miR-34a	CLIP-seq
MIRT989454	hsa-miR-34c-5p	CLIP-seq
MIRT989455	hsa-miR-449a	CLIP-seq
MIRT989456	hsa-miR-449b	CLIP-seq
MIRT989457	hsa-miR-4708-5p	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq
MIRT1993225	hsa-miR-1827	CLIP-seq
MIRT1993226	hsa-miR-185	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT1993227	hsa-miR-3194-3p	CLIP-seq
MIRT1993228	hsa-miR-326	CLIP-seq
MIRT1993229	hsa-miR-330-5p	CLIP-seq
MIRT1993230	hsa-miR-4306	CLIP-seq
MIRT1993231	hsa-miR-4644	CLIP-seq
MIRT1993232	hsa-miR-4667-5p	CLIP-seq
MIRT1993233	hsa-miR-4700-5p	CLIP-seq
MIRT1993234	hsa-miR-637	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq
MIRT2227101	hsa-miR-1207-5p	CLIP-seq
MIRT989450	hsa-miR-1225-5p	CLIP-seq
MIRT2227102	hsa-miR-1227	CLIP-seq
MIRT2227103	hsa-miR-1231	CLIP-seq
MIRT1993226	hsa-miR-185	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT1993227	hsa-miR-3194-3p	CLIP-seq
MIRT1993228	hsa-miR-326	CLIP-seq
MIRT1993229	hsa-miR-330-5p	CLIP-seq
MIRT989453	hsa-miR-34a	CLIP-seq
MIRT989454	hsa-miR-34c-5p	CLIP-seq
MIRT2227104	hsa-miR-4251	CLIP-seq
MIRT2227105	hsa-miR-4288	CLIP-seq
MIRT1993230	hsa-miR-4306	CLIP-seq
MIRT2227106	hsa-miR-4329	CLIP-seq
MIRT989455	hsa-miR-449a	CLIP-seq
MIRT989456	hsa-miR-449b	CLIP-seq
MIRT1993231	hsa-miR-4644	CLIP-seq
MIRT1993232	hsa-miR-4667-5p	CLIP-seq
MIRT2227107	hsa-miR-4687-3p	CLIP-seq
MIRT1993233	hsa-miR-4700-5p	CLIP-seq
MIRT2227108	hsa-miR-4763-3p	CLIP-seq
MIRT2227109	hsa-miR-632	CLIP-seq
MIRT1993234	hsa-miR-637	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	12351724
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	ISS
GO:0005737	Component	Cytoplasm	IDA	12351724
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0016322	Process	Neuron remodeling	IDA	12351724
GO:0016601	Process	Rac protein signal transduction	IDA	12351724
GO:0022405	Process	Hair cycle process	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	ISS
GO:0033623	Process	Regulation of integrin activation	IEA
GO:0033623	Process	Regulation of integrin activation	ISS
GO:0048468	Process	Cell development	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071800	Process	Podosome assembly	IEA
GO:0071800	Process	Podosome assembly	ISS

MIM	HGNC	e!Ensembl
617586	16460	ENSG00000006607

O94887

Protein name

FERM, ARHGEF and pleckstrin domain-containing protein 2 (FERM domain-including RhoGEF) (FIR) (FERM, RhoGEF and pleckstrin domain-containing protein 2) (Pleckstrin homology domain-containing family C member 3) (PH domain-containing family C member 3)

Protein function

Functions as a guanine nucleotide exchange factor that activates RAC1. May have relatively low activity. Plays a role in the response to class 3 semaphorins and remodeling of the actin cytoskeleton. Plays a role in TNFSF11-mediated osteoclast di

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09379	FERM_N	48 → 111	FERM N-terminal domain	Domain
PF00373	FERM_M	127 → 234	FERM central domain	Domain
PF09380	FERM_C	238 → 328	FERM C-terminal PH-like domain	Domain
PF08736	FA	333 → 376	FERM adjacent (FA)	Family
PF00621	RhoGEF	539 → 724	RhoGEF domain	Domain
PF00169	PH	756 → 852	PH domain	Domain
PF00169	PH	930 → 1026	PH domain	Domain

Sequence

MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE

Sequence length

1054

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Adherens junction		SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 2Q37 DELETION SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34115610, 37562399	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	37562399	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37940859	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	34672420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24247407, 24307987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	36566214	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	27094381	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	20855867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	20062064, 20855867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Stimulate	20062064	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	35354376	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Myopia	Associate	36036911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	34373545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	36254233	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34868391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34418989	★★★★★ ★☆☆☆☆ Found in Text Mining only

FARP2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2)