Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9846
Gene name Gene Name - the full gene name approved by the HGNC.
GRB2 associated binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAB2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q14.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the GRB2-associated binding protein (GAB) gene family. These proteins contain pleckstrin homology (PH) domain, and bind SHP2 tyrosine phosphatase and GRB2 adapter protein. They act as adapters for transmitting various signals in r
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006161 hsa-let-7g-5p Luciferase reporter assay, Microarray, Western blot 21868760
MIRT006161 hsa-let-7g-5p Luciferase reporter assay, Microarray, Western blot 21868760
MIRT006161 hsa-let-7g-5p Luciferase reporter assay, Microarray, Western blot 21868760
MIRT006161 hsa-let-7g-5p Luciferase reporter assay, Microarray, Western blot 21868760
MIRT006161 hsa-let-7g-5p Luciferase reporter assay, Microarray, Western blot 21868760
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IDA 19172738
GO:0005515 Function Protein binding IPI 15170389, 15750601, 16253990, 19172738, 19380743, 20936779, 21706016, 25416956, 31515488, 31585087, 31980649, 32296183, 32814053
GO:0005547 Function Phosphatidylinositol-3,4,5-trisphosphate binding ISS
GO:0005737 Component Cytoplasm IDA 19172738
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606203 14458 ENSG00000033327
Protein
UniProt ID Q9UQC2
Protein name GRB2-associated-binding protein 2 (GRB2-associated binder 2) (Growth factor receptor bound protein 2-associated protein 2) (pp100)
Protein function Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF1
PDB 2VWF , 2W0Z , 5EWZ , 5EXA , 6Y3R , 6Y3S , 6ZVB , 6ZVC , 6ZVD , 6ZVE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 7 117 PH domain Domain
Sequence
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICG
FNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
Sequence length 676
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ras signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Osteoclast differentiation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Chronic myeloid leukemia
  PI3K Cascade
Signaling by SCF-KIT
Signaling by cytosolic FGFR1 fusion mutants
Role of LAT2/NTAL/LAB on calcium mobilization
RET signaling
Interleukin receptor SHC signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
17553421, 21460841
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)
22535842
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 30940143 ClinVar
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 21552417
Adenocarcinoma Associate 28640357
Alzheimer Disease Associate 17553421, 19204163, 19262956, 20568290, 20634593, 20888920, 21497199, 22273362, 22856364, 23525328, 23724096, 25853819, 26680604, 28650998, 34103633
Antiphospholipid Syndrome Associate 37914735
Autoimmune Diseases Associate 29207374
Brain Diseases Associate 22856364
Breast Neoplasms Associate 16253990, 19838208, 21118992, 21552417, 26126114, 31002135, 31698596
Cancer Pain Associate 29880043
Carcinogenesis Associate 16253990
Carcinoma Hepatocellular Associate 27026230, 36421826