Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9837
Gene name Gene Name - the full gene name approved by the HGNC.
GINS complex subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GINS1
Synonyms (NCBI Gene) Gene synonyms aliases
IMD55, PSF1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg ext
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137901350 C>T Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs376610445 G>A Likely-pathogenic Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021144 hsa-miR-186-5p Sequencing 20371350
MIRT025773 hsa-miR-7-5p Microarray 19073608
MIRT029528 hsa-miR-26b-5p Microarray 19088304
MIRT040758 hsa-miR-18a-3p CLASH 23622248
MIRT083229 hsa-miR-19a-3p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000811 Component GINS complex IBA
GO:0000811 Component GINS complex IEA
GO:0000811 Component GINS complex IPI 17417653
GO:0001833 Process Inner cell mass cell proliferation IEA
GO:0005515 Function Protein binding IPI 17417653, 17652513, 32769987, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610608 28980 ENSG00000101003
Protein
UniProt ID Q14691
Protein name DNA replication complex GINS protein PSF1 (GINS complex subunit 1)
Protein function Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks (PubMed:17417653, PubMed:28414293). GINS complex is a core component of C
PDB 2E9X , 2EHO , 2Q9Q , 6XTX , 6XTY , 7PFO , 7PLO , 8B9D , 8OK2
Family and domains
Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIP
TIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRS
LATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHILS
Sequence length 196
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Unwinding of DNA
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Severe combined immunodeficiency disease combined immunodeficiency due to gins1 deficiency rs2146178281, rs376610445 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34852135
Breast Neoplasms Associate 20825491, 31758680, 40381037
Breast Neoplasms Stimulate 33725952
Carcinoma Hepatocellular Associate 25198552, 34852135
Carcinoma Renal Cell Associate 34852135
Chromosomal Instability Associate 36516748
COVID 19 Associate 36451247
Esophageal Squamous Cell Carcinoma Associate 34365093
Growth Disorders Associate 24027063
Inflammation Associate 37904396