Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9833
Gene name Gene Name - the full gene name approved by the HGNC.
Maternal embryonic leucine zipper kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MELK
Synonyms (NCBI Gene) Gene synonyms aliases
HPK38
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016391 hsa-miR-193b-3p Microarray 20304954
MIRT628572 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT628571 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT628570 hsa-miR-17-5p HITS-CLIP 23824327
MIRT628569 hsa-miR-20a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS 12400006
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IDA 12400006, 15908796, 16216881, 17280616
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607025 16870 ENSG00000165304
Protein
UniProt ID Q14680
Protein name Maternal embryonic leucine zipper kinase (hMELK) (EC 2.7.11.1) (Protein kinase Eg3) (pEg3 kinase) (Protein kinase PK38) (hPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2)
Protein function Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622
PDB 4BKY , 4BKZ , 4BL1 , 4D2P , 4D2T , 4D2V , 4D2W , 4IXP , 4UMP , 4UMQ , 4UMR , 4UMT , 4UMU , 5IH8 , 5IH9 , 5IHA , 5IHC , 5K00 , 5M5A , 5MAF , 5MAG , 5MAH , 5MAI , 5TVT , 5TWL , 5TWU , 5TWY , 5TWZ , 5TX3 , 6GVX , 6VXR , 9F31
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 11 263 Protein kinase domain Domain
PF02149 KA1 607 651 Kinase associated domain 1 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, kidney, thymus, testis, ovary and intestine. {ECO:0000269|PubMed:8724849}.
Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEA
LKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAV
AYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI
QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL
QQMLQVDPKKRISMKNLLNHPWI
MQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQT
MEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDV
TASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPI
KIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITV
LTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQT
QSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
Sequence length 651
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 26683690, 28640357
Adenocarcinoma of Lung Associate 23357462, 34304612
Adenocarcinoma of Lung Stimulate 38376289
Adrenal Gland Neoplasms Associate 29790920
Adrenocortical Carcinoma Associate 29790920
Ascites Associate 33078598
Breast Neoplasms Stimulate 17280616
Breast Neoplasms Associate 19671159, 25756514, 28214016, 28337968, 28926338, 30732163, 31352007, 35749404, 36096037, 36757135, 36930083, 37713876
Carcinogenesis Associate 17280616, 21338529, 35440604, 37949877
Carcinoma Ductal Associate 35749404