Gene Gene information from NCBI Gene database.
Entrez ID 9833
Gene name Maternal embryonic leucine zipper kinase
Gene symbol MELK
Synonyms (NCBI Gene)
HPK38
Chromosome 9
Chromosome location 9p13.2
miRNA miRNA information provided by mirtarbase database.
349
miRTarBase ID miRNA Experiments Reference
MIRT016391 hsa-miR-193b-3p Microarray 20304954
MIRT628572 hsa-miR-106a-5p HITS-CLIP 23824327
MIRT628571 hsa-miR-106b-5p HITS-CLIP 23824327
MIRT628570 hsa-miR-17-5p HITS-CLIP 23824327
MIRT628569 hsa-miR-20a-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS 12400006
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IDA 12400006, 15908796, 16216881, 17280616
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607025 16870 ENSG00000165304
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14680
Protein name Maternal embryonic leucine zipper kinase (hMELK) (EC 2.7.11.1) (Protein kinase Eg3) (pEg3 kinase) (Protein kinase PK38) (hPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2)
Protein function Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622
PDB 4BKY , 4BKZ , 4BL1 , 4D2P , 4D2T , 4D2V , 4D2W , 4IXP , 4UMP , 4UMQ , 4UMR , 4UMT , 4UMU , 5IH8 , 5IH9 , 5IHA , 5IHC , 5K00 , 5M5A , 5MAF , 5MAG , 5MAH , 5MAI , 5TVT , 5TWL , 5TWU , 5TWY , 5TWZ , 5TX3 , 6GVX , 6VXR , 9F31
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 11 263 Protein kinase domain Domain
PF02149 KA1 607 651 Kinase associated domain 1 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, kidney, thymus, testis, ovary and intestine. {ECO:0000269|PubMed:8724849}.
Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEA
LKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAV
AYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI
QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL
QQMLQVDPKKRISMKNLLNHPWI
MQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQT
MEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDV
TASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPI
KIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITV
LTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQT
QSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
Sequence length 651
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
9
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs114617403 RCV005910138
Clear cell carcinoma of kidney Benign rs114617403 RCV005910139
Colorectal cancer Benign rs114617403 RCV005910140
Gastric cancer Benign rs114617403 RCV005910142
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 26683690, 28640357
Adenocarcinoma of Lung Associate 23357462, 34304612
Adenocarcinoma of Lung Stimulate 38376289
Adrenal Gland Neoplasms Associate 29790920
Adrenocortical Carcinoma Associate 29790920
Ascites Associate 33078598
Breast Neoplasms Stimulate 17280616
Breast Neoplasms Associate 19671159, 25756514, 28214016, 28337968, 28926338, 30732163, 31352007, 35749404, 36096037, 36757135, 36930083, 37713876
Carcinogenesis Associate 17280616, 21338529, 35440604, 37949877
Carcinoma Ductal Associate 35749404