Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	983
Gene name	Cyclin dependent kinase 1
Gene symbol	CDK1
Synonyms (NCBI Gene)	CDC2CDC28AP34CDC2
Chromosome	10
Chromosome location	10q21.2
Summary	The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase trans

289

Show/Hide all (289)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT016140	hsa-miR-663a	Western blot;Other	20514450
MIRT016189	hsa-miR-590-3p	Sequencing	20371350
MIRT016442	hsa-miR-193b-3p	Microarray	20304954
MIRT030503	hsa-miR-24-3p	Microarray	19748357
MIRT030503	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	19748357
MIRT049057	hsa-miR-92a-3p	CLASH	23622248
MIRT438211	hsa-miR-302a-3p	qRT-PCRWestern blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCRWestern blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCRWestern blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCRWestern blot	24333727
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT732755	hsa-miR-125b-5p	Luciferase reporter assayWestern blotting	33859745
MIRT732872	hsa-miR-22-3p	Microarray	31848878
MIRT732873	hsa-miR-485-5p	Microarray	31848878
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT880273	hsa-miR-200b	CLIP-seq
MIRT880274	hsa-miR-200c	CLIP-seq
MIRT880275	hsa-miR-429	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq
MIRT880277	hsa-miR-4698	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880279	hsa-miR-329	CLIP-seq
MIRT880280	hsa-miR-362-3p	CLIP-seq
MIRT880281	hsa-miR-3941	CLIP-seq
MIRT880282	hsa-miR-4786-5p	CLIP-seq
MIRT880283	hsa-miR-582-5p	CLIP-seq
MIRT880284	hsa-miR-603	CLIP-seq
MIRT880285	hsa-miR-769-5p	CLIP-seq
MIRT880286	hsa-miR-1200	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880287	hsa-miR-3074-5p	CLIP-seq
MIRT880288	hsa-miR-330-3p	CLIP-seq
MIRT880289	hsa-miR-3545-3p	CLIP-seq
MIRT880290	hsa-miR-3688-3p	CLIP-seq
MIRT880291	hsa-miR-3913-3p	CLIP-seq
MIRT880292	hsa-miR-410	CLIP-seq
MIRT880293	hsa-miR-4261	CLIP-seq
MIRT880294	hsa-miR-4422	CLIP-seq
MIRT880295	hsa-miR-4795-3p	CLIP-seq
MIRT880296	hsa-miR-4803	CLIP-seq
MIRT880297	hsa-miR-489	CLIP-seq
MIRT880298	hsa-miR-495	CLIP-seq
MIRT880299	hsa-miR-548c-3p	CLIP-seq
MIRT880300	hsa-miR-656	CLIP-seq
MIRT880301	hsa-miR-888	CLIP-seq
MIRT1960803	hsa-miR-1179	CLIP-seq
MIRT1960804	hsa-miR-3685	CLIP-seq
MIRT1960805	hsa-miR-384	CLIP-seq
MIRT1960806	hsa-miR-4760-5p	CLIP-seq
MIRT1960807	hsa-miR-513a-3p	CLIP-seq
MIRT1960808	hsa-miR-628-3p	CLIP-seq
MIRT2446686	hsa-miR-3074-3p	CLIP-seq
MIRT2446687	hsa-miR-3121-3p	CLIP-seq
MIRT2446688	hsa-miR-3613-3p	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
E2F1	Activation	14618416
E2F3	Unknown	16909110
ETS2	Unknown	7867724
IRF1	Repression	22200613
PTTG1	Activation	22475756
RB1	Unknown	8270002
SMAD7	Repression	15023526
TFDP1	Activation	14618416
TP53	Repression	12889596
TP53	Unknown	19067706
TP73	Unknown	19067706

129

Show/Hide all (129)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	11687586
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	1312467
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488, 27030811
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	2188730, 2344612, 30139873
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	17495531
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	1312467, 17495531
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	34782749
GO:0000226	Process	Microtubule cytoskeleton organization	TAS	21655336
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	1312467
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0001618	Function	Virus receptor activity	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	22854038, 23574715
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	9001210
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	7588608, 11298763, 19879842, 21871177, 23509069, 25012651, 26829474, 27030108, 28479321, 31804178, 32491969, 34741373
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IDA	2188730, 2344612, 10791892, 11069302, 18477460, 19202191, 23601106, 25753036, 30139873, 34734636, 37788673
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IMP	24746669
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	7815540, 9001210, 9988268, 10373560, 11069302, 11574543, 11687586, 12612082, 15148369, 15657067, 17283331, 17349584, 17681274, 18337751, 18408765, 18477460, 19879842, 20395957, 21041660, 21871177, 23509069, 23543736, 23601106, 23602568, 23799914, 24218572, 24358021, 24658140, 252186
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15767402, 16109376
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15767402
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	19917720
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005813	Component	Centrosome	IDA	17488717
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IDA	11069302
GO:0006260	Process	DNA replication	TAS	21655336
GO:0006281	Process	DNA repair	TAS	21655336
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	19202191
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007077	Process	Mitotic nuclear membrane disassembly	IDA	2188730
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IBA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IEA
GO:0007098	Process	Centrosome cycle	TAS	19364923
GO:0007344	Process	Pronuclear fusion	TAS	21535261
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	12721286
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	24746669
GO:0014038	Process	Regulation of Schwann cell differentiation	TAS	17200138
GO:0014075	Process	Response to amine	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	28575661
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	TAS	17200138
GO:0016579	Process	Protein deubiquitination	IDA	16378762
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	27238018
GO:0030261	Process	Chromosome condensation	IEA
GO:0030332	Function	Cyclin binding	IDA	7739547
GO:0030332	Function	Cyclin binding	IPI	1312467, 24746669
GO:0030496	Component	Midbody	IDA	11069302
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0034501	Process	Protein localization to kinetochore	IDA	18195732
GO:0034501	Process	Protein localization to kinetochore	IMP	28479321
GO:0035173	Function	Histone kinase activity	IDA	21871177
GO:0035173	Function	Histone kinase activity	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	27238018
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11069302
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045740	Process	Positive regulation of DNA replication	IEA
GO:0045995	Process	Regulation of embryonic development	TAS	21535261
GO:0046105	Process	Thymidine biosynthetic process	IDA	14697231
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046688	Process	Response to copper ion	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046785	Process	Microtubule polymerization	IDA	10791892, 34782749
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0051301	Process	Cell division	IEA
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0061523	Process	Cilium disassembly	IDA	34782749
GO:0062033	Process	Positive regulation of mitotic sister chromatid segregation	IDA	26829474
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0090166	Process	Golgi disassembly	IEA
GO:0090166	Process	Golgi disassembly	ISS
GO:0097121	Component	Cyclin A1-CDK1 complex	NAS	19592082
GO:0097122	Component	Cyclin A2-CDK1 complex	IEA
GO:0097122	Component	Cyclin A2-CDK1 complex	NAS	1312467
GO:0097125	Component	Cyclin B1-CDK1 complex	IMP	24746669
GO:0097125	Component	Cyclin B1-CDK1 complex	IPI	17495531
GO:0097472	Function	Cyclin-dependent protein kinase activity	IDA	1312467
GO:0097472	Function	Cyclin-dependent protein kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110025	Process	DNA strand resection involved in replication fork processing	IDA	27814491, 27889449, 29670289, 30612738
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	21871177
GO:1902423	Process	Regulation of attachment of mitotic spindle microtubules to kinetochore	IDA	28479321
GO:1902850	Process	Microtubule cytoskeleton organization involved in mitosis	IDA	10791892
GO:1904860	Process	DNA synthesis involved in mitotic DNA replication	IDA	14697231
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IMP	24746669
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27814491, 27889449
GO:1990506	Process	Mitotic DNA-templated DNA replication	IDA	28575661

MIM	HGNC	e!Ensembl
116940	1722	ENSG00000170312

P06493

Protein name

Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)

Protein function

Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition via association with multiple interphase cyclins (PubMed:16407259, PubMed:16933150, PubMed:1745972

PDB

4Y72 , 4YC3 , 4YC6 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 6GU6 , 6GU7 , 6TWN , 7NJ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 287	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 2]: Found in breast cancer tissues. {ECO:0000269|PubMed:9515786}.

Sequence

MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Sequence length

297

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Gap junction Progesterone-mediated oocyte maturation Human immunodeficiency virus 1 infection Viral carcinogenesis		MAPK3 (ERK1) activation Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes APC/C:Cdc20 mediated degradation of Cyclin B Cdc20:Phospho-APC/C mediated degradation of Cyclin A Regulation of APC/C activators between G1/S and early anaphase Phosphorylation of the APC/C Phosphorylation of Emi1 Condensation of Prophase Chromosomes Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Depolymerisation of the Nuclear Lamina Anchoring of the basal body to the plasma membrane MAPK6/MAPK4 signaling Ovarian tumor domain proteases TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Regulation of TP53 Degradation Mitotic Prophase Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex The role of GTSE1 in G2/M progression after G2 checkpoint AURKA Activation by TPX2 Transcriptional regulation by RUNX2

CDK1 (cyclin dependent kinase 1)