Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	983
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDK1
Synonyms (NCBI Gene) Gene synonyms aliases	CDC2, CDC28A, P34CDC2
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase trans

Show/Hide all(289)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT007328	hsa-miR-31-5p	Luciferase reporter assay	23233736
MIRT016140	hsa-miR-663a	Western blot;Other	20514450
MIRT016189	hsa-miR-590-3p	Sequencing	20371350
MIRT016442	hsa-miR-193b-3p	Microarray	20304954
MIRT030503	hsa-miR-24-3p	Microarray	19748357
MIRT030503	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	19748357
MIRT049057	hsa-miR-92a-3p	CLASH	23622248
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT438211	hsa-miR-302a-3p	qRT-PCR, Western blot	24333727
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT732755	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT732872	hsa-miR-22-3p	Microarray	31848878
MIRT732873	hsa-miR-485-5p	Microarray	31848878
MIRT262868	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT262866	hsa-miR-3910	HITS-CLIP	23313552
MIRT262867	hsa-miR-4714-5p	HITS-CLIP	23313552
MIRT691639	hsa-miR-514a-5p	HITS-CLIP	23313552
MIRT691638	hsa-miR-3664-5p	HITS-CLIP	23313552
MIRT262862	hsa-miR-935	HITS-CLIP	23313552
MIRT691637	hsa-miR-205-5p	HITS-CLIP	23313552
MIRT262858	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT262861	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT691636	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT262860	hsa-miR-556-3p	HITS-CLIP	23313552
MIRT262863	hsa-miR-4256	HITS-CLIP	23313552
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT507822	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507821	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507819	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000268	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT507817	hsa-miR-4310	PAR-CLIP	20371350
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT558812	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT507815	hsa-miR-4468	PAR-CLIP	20371350
MIRT562532	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562531	hsa-miR-107	PAR-CLIP	20371350
MIRT507814	hsa-miR-2053	PAR-CLIP	20371350
MIRT330659	hsa-miR-5688	PAR-CLIP	21572407
MIRT330658	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT558816	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT558815	hsa-miR-641	PAR-CLIP	21572407
MIRT330640	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT330635	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT262855	hsa-miR-5585-5p	PAR-CLIP	21572407
MIRT262854	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT558814	hsa-miR-3161	PAR-CLIP	21572407
MIRT558813	hsa-miR-599	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT558812	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT507822	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507821	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507819	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT000268	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT507817	hsa-miR-4310	PAR-CLIP	21572407
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507815	hsa-miR-4468	PAR-CLIP	21572407
MIRT507814	hsa-miR-2053	PAR-CLIP	21572407
MIRT507823	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT507822	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507821	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507820	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507819	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT000268	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507818	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT507817	hsa-miR-4310	PAR-CLIP	23446348
MIRT507816	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507815	hsa-miR-4468	PAR-CLIP	23446348
MIRT507814	hsa-miR-2053	PAR-CLIP	23446348
MIRT495648	hsa-miR-548aa	PAR-CLIP	22291592
MIRT495647	hsa-miR-548ap-3p	PAR-CLIP	22291592
MIRT495646	hsa-miR-548t-3p	PAR-CLIP	22291592
MIRT495645	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT495644	hsa-miR-548at-3p	PAR-CLIP	22291592
MIRT495643	hsa-miR-548ay-3p	PAR-CLIP	22291592
MIRT495642	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495641	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT495640	hsa-miR-488-5p	PAR-CLIP	22291592
MIRT880273	hsa-miR-200b	CLIP-seq
MIRT880274	hsa-miR-200c	CLIP-seq
MIRT880275	hsa-miR-429	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq
MIRT880277	hsa-miR-4698	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880279	hsa-miR-329	CLIP-seq
MIRT880280	hsa-miR-362-3p	CLIP-seq
MIRT880281	hsa-miR-3941	CLIP-seq
MIRT880282	hsa-miR-4786-5p	CLIP-seq
MIRT880283	hsa-miR-582-5p	CLIP-seq
MIRT880284	hsa-miR-603	CLIP-seq
MIRT880285	hsa-miR-769-5p	CLIP-seq
MIRT880286	hsa-miR-1200	CLIP-seq
MIRT880278	hsa-miR-203	CLIP-seq
MIRT880287	hsa-miR-3074-5p	CLIP-seq
MIRT880288	hsa-miR-330-3p	CLIP-seq
MIRT880289	hsa-miR-3545-3p	CLIP-seq
MIRT880290	hsa-miR-3688-3p	CLIP-seq
MIRT880291	hsa-miR-3913-3p	CLIP-seq
MIRT880292	hsa-miR-410	CLIP-seq
MIRT880293	hsa-miR-4261	CLIP-seq
MIRT880294	hsa-miR-4422	CLIP-seq
MIRT880295	hsa-miR-4795-3p	CLIP-seq
MIRT880296	hsa-miR-4803	CLIP-seq
MIRT880297	hsa-miR-489	CLIP-seq
MIRT880298	hsa-miR-495	CLIP-seq
MIRT880299	hsa-miR-548c-3p	CLIP-seq
MIRT880300	hsa-miR-656	CLIP-seq
MIRT880301	hsa-miR-888	CLIP-seq
MIRT1960803	hsa-miR-1179	CLIP-seq
MIRT1960804	hsa-miR-3685	CLIP-seq
MIRT1960805	hsa-miR-384	CLIP-seq
MIRT1960806	hsa-miR-4760-5p	CLIP-seq
MIRT1960807	hsa-miR-513a-3p	CLIP-seq
MIRT1960808	hsa-miR-628-3p	CLIP-seq
MIRT2446686	hsa-miR-3074-3p	CLIP-seq
MIRT2446687	hsa-miR-3121-3p	CLIP-seq
MIRT2446688	hsa-miR-3613-3p	CLIP-seq
MIRT880276	hsa-miR-4495	CLIP-seq

Transcription factors

Show/Hide all(12)

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
E2F1	Activation	14618416
E2F3	Unknown	16909110
ETS2	Unknown	7867724
IRF1	Repression	22200613
PTTG1	Activation	22475756
RB1	Unknown	8270002
SMAD7	Repression	15023526
TFDP1	Activation	14618416
TP53	Repression	12889596
TP53	Unknown	19067706
TP73	Unknown	19067706

Show/Hide all(74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA	21873635
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000226	Process	Microtubule cytoskeleton organization	TAS	21655336
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	1312467
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0001618	Function	Virus receptor activity	IEA
GO:0004672	Function	Protein kinase activity	IDA	22854038, 23574715
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	7588608, 11298763, 19879842, 21871177, 23509069, 27030108
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IDA	11069302, 18477460, 23601106
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IMP	24746669
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	7815540, 9001210, 9988268, 10373560, 11069302, 11574543, 11687586, 12612082, 15148369, 15657067, 17283331, 17349584, 17681274, 18337751, 18408765, 18477460, 19879842, 20395957, 21041660, 21871177, 23509069, 23601106, 23602568, 23799914, 24218572, 24358021, 24658140, 25218637, 254169
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15767402, 16109376
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15767402
GO:0005739	Component	Mitochondrion	TAS	19917720
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005813	Component	Centrosome	IDA	17488717
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005876	Component	Spindle microtubule	IDA	11069302
GO:0006260	Process	DNA replication	TAS	21655336
GO:0006281	Process	DNA repair	TAS	21655336
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	23509069, 23574715, 30723163
GO:0006468	Process	Protein phosphorylation	IMP	24746669
GO:0006915	Process	Apoptotic process	IEA
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007095	Process	Mitotic G2 DNA damage checkpoint	IBA	21873635
GO:0007098	Process	Centrosome cycle	TAS	19364923
GO:0007344	Process	Pronuclear fusion	TAS	21535261
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA	21873635
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	12721286
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	24746669
GO:0014038	Process	Regulation of Schwann cell differentiation	TAS	17200138
GO:0016020	Component	Membrane	HDA	19946888
GO:0016477	Process	Cell migration	TAS	17200138
GO:0016572	Process	Histone phosphorylation	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	11298763, 19879842
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	11298763
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	27238018
GO:0030332	Function	Cyclin binding	IDA	7739547
GO:0030332	Function	Cyclin binding	IPI	1312467, 24746669
GO:0030496	Component	Midbody	IDA	11069302
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0034501	Process	Protein localization to kinetochore	IDA	18195732
GO:0035173	Function	Histone kinase activity	IDA	21871177
GO:0042752	Process	Regulation of circadian rhythm	IMP	27238018
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11069302
GO:0045995	Process	Regulation of embryonic development	TAS	21535261
GO:0046718	Process	Viral entry into host cell	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051301	Process	Cell division	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0090166	Process	Golgi disassembly	ISS
GO:0097125	Component	Cyclin B1-CDK1 complex	IMP	24746669
GO:0097472	Function	Cyclin-dependent protein kinase activity	IDA	1312467
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	21871177
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IMP	24746669

MIM	HGNC	e!Ensembl
116940	1722	ENSG00000170312

Protein

UniProt ID

P06493

Protein name

Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)

Protein function

Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition via association with multiple interphase cyclins (PubMed:16407259, PubMed:16933150, PubMed:1745972

PDB

4Y72 , 4YC3 , 4YC6 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 6GU6 , 6GU7 , 6TWN , 7NJ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 287	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 2]: Found in breast cancer tissues. {ECO:0000269|PubMed:9515786}.

Sequence

MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Sequence length

297

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Gap junction Progesterone-mediated oocyte maturation Human immunodeficiency virus 1 infection Viral carcinogenesis		MAPK3 (ERK1) activation Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes APC/C:Cdc20 mediated degradation of Cyclin B Cdc20:Phospho-APC/C mediated degradation of Cyclin A Regulation of APC/C activators between G1/S and early anaphase Phosphorylation of the APC/C Phosphorylation of Emi1 Condensation of Prophase Chromosomes Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Depolymerisation of the Nuclear Lamina Anchoring of the basal body to the plasma membrane MAPK6/MAPK4 signaling Ovarian tumor domain proteases TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Regulation of TP53 Degradation Mitotic Prophase Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex The role of GTSE1 in G2/M progression after G2 checkpoint AURKA Activation by TPX2 Transcriptional regulation by RUNX2

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	19223503

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dermatitis	Dermatitis			GWAS

Show/Hide Text Mining Associations (165)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	9242535
Acquired ichthyosis	Associate	36303457
Acute Aortic Syndrome	Associate	31721906
Adenocarcinoma	Associate	24367507, 28526810, 31116002
Adenocarcinoma Follicular	Associate	32093341
Adenocarcinoma of Lung	Associate	27835911, 31698633, 31854219, 32221746, 32233528, 32578582, 33126397, 34039308, 34397869, 34446056, 34814370, 35406786, 35783192, 35810236, 36078096 View all (6 more)
Adenoma	Associate	28004354
Adenomatous Polyposis Coli	Associate	34370741
Adrenocortical Carcinoma	Associate	30413320, 32147961, 32923148, 35123514, 37535572, 38053725
Altitude Sickness	Inhibit	33393628
Alzheimer Disease	Associate	11106571, 18076107, 21811019
Aneuploidy	Associate	17419986, 33168930
Anophthalmia with pulmonary hypoplasia	Associate	39358545
Aortic Dissection	Associate	31721906
Arthritis Rheumatoid	Associate	32840301
Ataxia Telangiectasia	Associate	11952644, 35782055
Bloom Syndrome	Associate	35119917
Brain Concussion	Stimulate	30644102
Brain Damage Chronic	Associate	38554980
Breast Neoplasms	Associate	12049736, 19377877, 21821547, 21918689, 22094936, 22108518, 22580043, 24386390, 24444383, 25756514, 26691213, 28335434, 28739725, 28855742, 29196913 View all (23 more)
Breast Neoplasms	Stimulate	21488187, 34895070
Carcinogenesis	Associate	16784539, 24386425, 26912061, 33178832, 35403252, 35782055, 36572570
Carcinoid Tumor	Inhibit	26008974
Carcinoma Adenoid Cystic	Associate	31914060, 37861550
Carcinoma Ductal Breast	Associate	14645695
Carcinoma Embryonal	Associate	19259937
Carcinoma Hepatocellular	Associate	15145941, 15298730, 21824427, 24083576, 25547487, 26002580, 26536659, 26755347, 26975930, 28381168, 28434945, 28640074, 29658607, 29728556, 29843214 View all (49 more)
Carcinoma Hepatocellular	Stimulate	34187556
Carcinoma Hepatocellular	Inhibit	40389832
Carcinoma Non Small Cell Lung	Associate	19683496, 28946554, 30195659, 31378747, 31805030, 32948832, 33126319, 33629305, 35039611, 39457373
Carcinoma Ovarian Epithelial	Associate	25910705, 32414422, 34794761
Carcinoma Pancreatic Ductal	Associate	30765611, 35011251, 35403252
Carcinoma Papillary	Associate	33723286
Carcinoma Renal Cell	Associate	25443276, 27144525, 27863441, 29559845, 30597305, 34870494, 35601741, 36152754, 37464398
Carcinoma Squamous Cell	Associate	25013792, 25849598, 31035650, 31642613, 36247089, 36714024, 37185598, 37442189
Cerebral Infarction	Associate	35485294
Cholangiocarcinoma	Associate	31545466, 36224755
Chondrosarcoma	Associate	26555773
Chromosomal Instability	Associate	27384476, 33168930, 36516748
Cleft Palate	Associate	26795696
Cocaine Related Disorders	Associate	23958962
Colorectal Neoplasms	Stimulate	15317660
Colorectal Neoplasms	Associate	22108518, 23799036, 24009741, 24098334, 25511643, 26506418, 27383761, 27546461, 28177905, 28486948, 29663854, 31137244, 31375708, 32127012, 32737302 View all (13 more)
COVID 19	Associate	33839760, 35749386, 36551164, 39259097
Cystitis	Associate	34080795
Dermatitis Atopic	Associate	33289509
Diabetes Gestational	Associate	30474315
Diabetes Mellitus	Associate	31315286, 35628588
Diabetes Mellitus Type 1	Associate	36303457
Dissection Thoracic Aorta	Associate	31751374
DNA Virus Infections	Stimulate	16847100
DNA Virus Infections	Associate	30067982, 31043526
Drug Related Side Effects and Adverse Reactions	Associate	30045664
Endometrial Neoplasms	Associate	28040131, 28682437, 33859719
Endometriosis	Associate	32112646, 35303800
Ependymoma	Associate	30649797
Epstein Barr Virus Infections	Associate	23330000
Esophageal Neoplasms	Associate	24829906, 25450480, 27585443, 34488675
Esophageal Squamous Cell Carcinoma	Associate	32546690, 32662828, 34232175, 34517565, 34586751
Fanconi Anemia	Associate	15082718, 9242535
Fever	Stimulate	15204521
Fever	Inhibit	29901106
Fibrosis	Associate	28640074, 35713317
Gastritis	Associate	10623670
Glioblastoma	Associate	29901201, 32467990, 33707466, 38003585, 39528802, 40649712
Glioma	Associate	23133576, 30015885, 30405856, 33892537, 35774141, 39991761
Glomerulonephritis Membranous	Associate	30865617
Hematoma Subdural Chronic	Associate	38554980
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21488187, 9006317
HIV Infections	Associate	23330000
HIV Infections	Inhibit	32903610
Hypertelorism with esophageal abnormality and hypospadias	Associate	11098059, 12208959
Infertility	Associate	32112646, 36303457
Inflammation	Associate	32877684, 36152754, 36685500, 37861550
Inflammation	Inhibit	38554980
Influenza Human	Associate	35367281
Iron Overload	Stimulate	35738066
Kidney Neoplasms	Associate	29843367, 37047552
Laryngeal Neoplasms	Associate	25120812
Leukemia	Stimulate	12417757
Leukemia	Associate	23518499
Leukemia Lymphoma Adult T Cell	Associate	19131553, 21414204
Leukemia Myeloid Acute	Associate	19385969, 23518499, 25844667, 35634845, 36509894
Leukemia Promyelocytic Acute	Associate	36813923
Liver Cirrhosis	Associate	37861550, 40332418
Lown Ganong Levine Syndrome	Associate	24386390
Lung Diseases	Associate	32457348
Lung Neoplasms	Associate	21887332, 28592245, 30002440, 31378894, 31854219, 32020821, 32646340, 33685293, 36714024
Lupus Erythematosus Systemic	Associate	28740209, 37072474
Lupus Nephritis	Associate	28740209
Lymphatic Metastasis	Associate	24386425
Lymphatic Metastasis	Stimulate	25129248
Lymphoma	Associate	12068134, 15015605
Lymphoma B Cell Marginal Zone	Associate	10623670
Lymphoma Large B Cell Diffuse	Associate	23330000, 37072474, 39773464, 40615583
Lymphoma Mantle Cell	Associate	15933757, 18416826
Lymphoma Non Hodgkin	Associate	12068134
Lymphoma Primary Effusion	Associate	22496227
Malformations of Cortical Development Group I	Associate	19124971
Medulloblastoma	Associate	29984917, 30678435
Melanoma	Associate	10497214, 19305423, 19478684, 25831048, 30792348, 32612115, 36303457
Melanoma	Stimulate	35906389
Meningioma	Associate	21157382, 37515398
Mesothelioma Malignant	Stimulate	19218339
Mesothelioma Malignant	Associate	24327015, 33032291
Mitochondrial Diseases	Associate	19385969
Mosaic variegated aneuploidy syndrome	Associate	16847100
Mouth Neoplasms	Associate	27031247
Multiple Myeloma	Associate	26724804, 31048671, 32060401, 33197893
Myocarditis	Associate	36226312
Myopathies Structural Congenital	Stimulate	36069218
Nasopharyngeal Carcinoma	Associate	27149165, 34064109, 34585634, 34664875, 35251377, 35509856, 35712071, 38050231
Nasopharyngeal Neoplasms	Associate	27149165
Necrosis	Associate	37861550
Neoplasm Metastasis	Associate	22108518, 33178832, 35054979, 35906389, 36813923, 39773464
Neoplasms	Associate	11161389, 11305412, 12049736, 12771130, 12819026, 14645695, 15317660, 15973768, 15990281, 16818887, 16908595, 17043241, 17233903, 19385969, 19528450 View all (78 more)
Neoplasms	Inhibit	20332213
Neoplasms	Stimulate	29901201, 32886452, 35592706, 35723742
Neoplasms Germ Cell and Embryonal	Associate	26029996
Nerve Degeneration	Associate	19124971
Neuroblastoma	Associate	26029996
Neurodegenerative Diseases	Associate	19124971, 19476463
Nijmegen Breakage Syndrome	Associate	11952644
Osteoarthritis	Associate	26555773
Osteochondritis	Associate	31758856
Osteosarcoma	Associate	29845265, 32665038, 34156352, 35056691, 38297292
Ovarian Neoplasms	Associate	25910705, 27039763, 29575713, 29758922, 32886452, 34072728, 34253236, 35843311
Ovarian Neoplasms	Stimulate	34794761
Paget Disease Extramammary	Associate	34292991
Pancreatic Neoplasms	Associate	17196098, 32537471, 39310930
Pancreatic Neoplasms	Stimulate	37923686
Papilloma Inverted	Associate	25013792
Papillomavirus Infections	Associate	15917406
Paranoid Disorders	Associate	23958962
Personality Disorders	Associate	21157382
Pneumonia Pneumocystis	Associate	21251557
Post Acute COVID 19 Syndrome	Associate	36890149
Post Infectious Disorders	Associate	26810418
Prostatic Neoplasms	Associate	12771130, 15961392, 17043241, 21867506, 21969818, 23321516, 24079846, 25519703, 26824323, 27029529, 28062857, 31300540, 33178832, 33932081, 33994848 View all (7 more)
Prostatic Neoplasms Castration Resistant	Associate	28062857, 33994848
Psoriasis	Associate	33416099
Pulmonary Arterial Hypertension	Associate	32586319
Pulmonary Disease Chronic Obstructive	Associate	34704847
Renal Insufficiency Chronic	Associate	31257514
Retinoblastoma	Associate	33217867
Rhabdomyosarcoma	Associate	31870357
Sepsis	Associate	39259097
Sjogren's Syndrome	Associate	36171070
Skin Diseases	Associate	33416099
Small Cell Lung Carcinoma	Associate	31746355, 34397869
Squamous Cell Carcinoma of Head and Neck	Associate	23874958, 24386425, 25120812, 25129248, 26409447, 27644244, 30468474, 31210307, 35176168, 35806389, 37178584, 37401236
Squamous Cell Carcinoma of Head and Neck	Stimulate	26912061, 33982750
Stomach Neoplasms	Associate	17722244, 32759885, 33446695, 36167685
Thyroid Cancer Papillary	Associate	26810418, 31591432
Thyroid Carcinoma Anaplastic	Associate	30213925, 31183379, 33025856, 33455115
Triple Negative Breast Neoplasms	Associate	35056723, 36238993, 36782089, 36813923, 36998242, 37667382, 38170155, 39819723
Urinary Bladder Neoplasms	Associate	29532898, 33000254, 36181054, 37740761, 39456780
Urinary Bladder Neoplasms	Stimulate	33217824
Uterine Cervical Dysplasia	Associate	31642613, 35008799
Uterine Cervical Neoplasms	Associate	26701206, 27626412, 31337953, 34116656, 35409328, 9201712
Uterine Cervicitis	Associate	15917406
Uterine Diseases	Associate	35303800
Vitiligo	Associate	33790887, 36890149
Wilms Tumor	Associate	30664180
Zika Virus Infection	Stimulate	35412344

CDK1 (cyclin dependent kinase 1)