Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9826
Gene name	Rho guanine nucleotide exchange factor 11
Gene symbol	ARHGEF11
Synonyms (NCBI Gene)	GTRAP48PDZ-RHOGEF
Chromosome	1
Chromosome location	1q23.1
Summary	Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A sim

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT707303	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707302	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707301	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707300	hsa-miR-3924	HITS-CLIP	21572407
MIRT707299	hsa-miR-6083	HITS-CLIP	21572407
MIRT707298	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707303	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707302	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707301	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707300	hsa-miR-3924	HITS-CLIP	21572407
MIRT707299	hsa-miR-6083	HITS-CLIP	21572407
MIRT707298	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT795308	hsa-miR-139-5p	CLIP-seq
MIRT795309	hsa-miR-2110	CLIP-seq
MIRT795310	hsa-miR-3977	CLIP-seq
MIRT795311	hsa-miR-4271	CLIP-seq
MIRT795312	hsa-miR-4420	CLIP-seq
MIRT795313	hsa-miR-4725-3p	CLIP-seq
MIRT795314	hsa-miR-491-5p	CLIP-seq
MIRT795315	hsa-miR-548c-3p	CLIP-seq
MIRT795316	hsa-miR-299-3p	CLIP-seq
MIRT795317	hsa-miR-3151	CLIP-seq
MIRT795318	hsa-miR-3177-5p	CLIP-seq
MIRT795319	hsa-miR-329	CLIP-seq
MIRT795320	hsa-miR-338-3p	CLIP-seq
MIRT795321	hsa-miR-338-5p	CLIP-seq
MIRT795322	hsa-miR-342-5p	CLIP-seq
MIRT795323	hsa-miR-3613-3p	CLIP-seq
MIRT795324	hsa-miR-3616-3p	CLIP-seq
MIRT795325	hsa-miR-362-3p	CLIP-seq
MIRT795326	hsa-miR-3941	CLIP-seq
MIRT795327	hsa-miR-3973	CLIP-seq
MIRT795328	hsa-miR-3974	CLIP-seq
MIRT795329	hsa-miR-4310	CLIP-seq
MIRT795330	hsa-miR-4436b-3p	CLIP-seq
MIRT795331	hsa-miR-4447	CLIP-seq
MIRT795332	hsa-miR-4472	CLIP-seq
MIRT795333	hsa-miR-4481	CLIP-seq
MIRT795334	hsa-miR-4488	CLIP-seq
MIRT795335	hsa-miR-4491	CLIP-seq
MIRT795336	hsa-miR-4530	CLIP-seq
MIRT795337	hsa-miR-4651	CLIP-seq
MIRT795338	hsa-miR-4657	CLIP-seq
MIRT795339	hsa-miR-4664-5p	CLIP-seq
MIRT795340	hsa-miR-4697-5p	CLIP-seq
MIRT795341	hsa-miR-4699-3p	CLIP-seq
MIRT795342	hsa-miR-4710	CLIP-seq
MIRT795343	hsa-miR-4721	CLIP-seq
MIRT795344	hsa-miR-4745-5p	CLIP-seq
MIRT795345	hsa-miR-4758-5p	CLIP-seq
MIRT795346	hsa-miR-4789-3p	CLIP-seq
MIRT795347	hsa-miR-4792	CLIP-seq
MIRT795314	hsa-miR-491-5p	CLIP-seq
MIRT795348	hsa-miR-520g	CLIP-seq
MIRT795349	hsa-miR-520h	CLIP-seq
MIRT795350	hsa-miR-548p	CLIP-seq
MIRT795351	hsa-miR-591	CLIP-seq
MIRT795352	hsa-miR-603	CLIP-seq
MIRT795353	hsa-miR-608	CLIP-seq
MIRT795354	hsa-miR-766	CLIP-seq
MIRT795355	hsa-miR-873	CLIP-seq
MIRT1934815	hsa-miR-516b	CLIP-seq
MIRT795308	hsa-miR-139-5p	CLIP-seq
MIRT1934816	hsa-miR-1972	CLIP-seq
MIRT795309	hsa-miR-2110	CLIP-seq
MIRT1934817	hsa-miR-3678-5p	CLIP-seq
MIRT795310	hsa-miR-3977	CLIP-seq
MIRT795311	hsa-miR-4271	CLIP-seq
MIRT795329	hsa-miR-4310	CLIP-seq
MIRT795312	hsa-miR-4420	CLIP-seq
MIRT795333	hsa-miR-4481	CLIP-seq
MIRT795342	hsa-miR-4710	CLIP-seq
MIRT1934818	hsa-miR-4716-3p	CLIP-seq
MIRT795313	hsa-miR-4725-3p	CLIP-seq
MIRT795344	hsa-miR-4745-5p	CLIP-seq
MIRT795314	hsa-miR-491-5p	CLIP-seq
MIRT1934816	hsa-miR-1972	CLIP-seq
MIRT2174599	hsa-miR-3150a-3p	CLIP-seq
MIRT2174600	hsa-miR-3175	CLIP-seq
MIRT795324	hsa-miR-3616-3p	CLIP-seq
MIRT795326	hsa-miR-3941	CLIP-seq
MIRT2174601	hsa-miR-4270	CLIP-seq
MIRT795330	hsa-miR-4436b-3p	CLIP-seq
MIRT2174602	hsa-miR-4441	CLIP-seq
MIRT2174603	hsa-miR-4468	CLIP-seq
MIRT2174604	hsa-miR-4654	CLIP-seq
MIRT795343	hsa-miR-4721	CLIP-seq
MIRT2174605	hsa-miR-4769-5p	CLIP-seq
MIRT795314	hsa-miR-491-5p	CLIP-seq
MIRT2174606	hsa-miR-664	CLIP-seq
MIRT795355	hsa-miR-873	CLIP-seq
MIRT2174607	hsa-miR-939	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	10026210
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0001664	Function	G protein-coupled receptor binding	IDA	15755723
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	10026210
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	10026210, 15530360, 17474147, 20300064, 20844236, 21988832, 22632972, 28514442, 32203420, 33961781, 34591642
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15755723
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006941	Process	Striated muscle contraction	NAS	10026210
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	15755723
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10026210
GO:0007266	Process	Rho protein signal transduction	IDA	10026210
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030010	Process	Establishment of cell polarity	NAS	10026210
GO:0030036	Process	Actin cytoskeleton organization	NAS	10026210
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10026210
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
605708	14580	ENSG00000132694

O15085

Protein name

Rho guanine nucleotide exchange factor 11 (PDZ-RhoGEF)

Protein function

May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and G

PDB

1HTJ , 1XCG , 2DLS , 3KZ1 , 3T06 , 5E6P , 5JHG , 5JHH , 5TYT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	47 → 120	PDZ domain	Domain
PF09128	RGS-like	307 → 486	Regulator of G protein signalling-like domain	Domain
PF00621	RhoGEF	738 → 921	RhoGEF domain	Domain
PF17838	PH_16	950 → 1079	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:10026210}.

Sequence

MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP

Sequence length

1522

Interactions

View interactions

	KEGG		Reactome
	Vascular smooth muscle contraction Parathyroid hormone synthesis, secretion and action Pathogenic Escherichia coli infection Human cytomegalovirus infection Pathways in cancer		NRAGE signals death through JNK Rho GTPase cycle G alpha (12/13) signalling events Sema4D induced cell migration and growth-cone collapse

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	16691626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	33122451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	25319871	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	18497548	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	33122451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	16691626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	33122451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	33122451	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	25319871	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ARHGEF11 (Rho guanine nucleotide exchange factor 11)