Gene Gene information from NCBI Gene database.
Entrez ID 9811
Gene name Cap binding complex dependent translation initiation factor
Gene symbol CTIF
Synonyms (NCBI Gene)
Gm672KIAA0427
Chromosome 18
Chromosome location 18q21.1
Summary CTIF is a component of the CBP80 (NCBP1; MIM 600469)/CBP20 (NCBP2; MIM 605133) translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step
miRNA miRNA information provided by mirtarbase database.
261
miRTarBase ID miRNA Experiments Reference
MIRT037103 hsa-miR-877-3p CLASH 23622248
MIRT659281 hsa-miR-4667-3p HITS-CLIP 23824327
MIRT659280 hsa-miR-5193 HITS-CLIP 23824327
MIRT659279 hsa-miR-18a-3p HITS-CLIP 23824327
MIRT659278 hsa-miR-4290 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay IEA
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay IMP 19648179
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 19648179, 28514442, 32296183
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613178 23925 ENSG00000134030
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43310
Protein name CBP80/20-dependent translation initiation factor
Protein function Specifically required for the pioneer round of mRNA translation mediated by the cap-binding complex (CBC), that takes place during or right after mRNA export via the nuclear pore complex (NPC). Acts via its interaction with the NCBP1/CBP80 compo
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02854 MIF4G 373 577 MIF4G domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19648179}.
Sequence
MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQ
WTADCSEPLDSSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL
DFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEI
AHTKKLFRRRRNDRRRQQRPPGGNKPQQHGDHQPGSAKHNRDHQKSYQGGSAPHPSGRPT
HHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSP
DTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRLRRRLKEKDEV
AVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQK
AVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITF
LCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLP
EMMTELLASARDKMLCPSESMLTRSLLLEVIELHANS
WNPLTPPITQYYNRTIQKLTA
Sequence length 598
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs75687084 RCV005904976
Colon adenocarcinoma Likely benign rs146773532 RCV005929848
Gastric cancer Likely benign rs146773532 RCV005929850
Malignant tumor of esophagus Likely benign rs146773532 RCV005929849
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 18676749