Gene Gene information from NCBI Gene database.
Entrez ID 9805
Gene name Secernin 1
Gene symbol SCRN1
Synonyms (NCBI Gene)
SES1
Chromosome 7
Chromosome location 7p14.3
Summary This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
miRNA miRNA information provided by mirtarbase database.
887
miRTarBase ID miRNA Experiments Reference
MIRT031060 hsa-miR-21-5p Microarray 18591254
MIRT032457 hsa-let-7b-5p Proteomics 18668040
MIRT050057 hsa-miR-26a-5p CLASH 23622248
MIRT036155 hsa-miR-320c CLASH 23622248
MIRT447929 hsa-miR-4426 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 32812023, 32814053, 33961781, 35063084
GO:0005634 Component Nucleus IDA 10942595
GO:0005737 Component Cytoplasm IEA
GO:0006508 Process Proteolysis IEA
GO:0006887 Process Exocytosis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614965 22192 ENSG00000136193
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12765
Protein name Secernin-1
Protein function Regulates exocytosis in mast cells. Increases both the extent of secretion and the sensitivity of mast cells to stimulation with calcium (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03577 Peptidase_C69 34 234 Peptidase family C69 Family
Sequence
MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISID
QVPRTYAIMISRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERG
ETAKEALDVIVSLLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKV
TEGVRCICSQLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEVFSPVEDHLD
CGAGKD
SLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVSVLPQNRSSPCIHYFTGTPDP
SRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWARAIIES
DQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK
Sequence length 414
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920979, rs864622024 RCV000149072
RCV000204152
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 24098497
Colorectal Neoplasms Stimulate 25814779
Colorectal Neoplasms Associate 37691034
Epstein Barr Virus Infections Associate 23829175
Leukemia Myeloid Acute Associate 24378410
Lymphoma Non Hodgkin Associate 18927283
Neoplasms Stimulate 25814779
Oculocerebrorenal Syndrome Associate 20133602
Prostatic Neoplasms Inhibit 25667921
Squamous Cell Carcinoma of Head and Neck Associate 37691034