Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9793
Gene name	Cytoskeleton associated protein 5
Gene symbol	CKAP5
Synonyms (NCBI Gene)	CHTOGMSPSTOGTOGpch-TOG
Chromosome	11
Chromosome location	11p11.2
Summary	This gene encodes a cytoskeleton-associated protein which belongs to the TOG/XMAP215 family. The N-terminal half of this protein contains a microtubule-binding domain and the C-terminal half contains a KXGS motif for binding tubulin dimers. This protein h

143

Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT006116	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	21799781
MIRT020260	hsa-miR-130b-3p	Sequencing	20371350
MIRT006116	hsa-miR-155-5p	Proteomics	18668040
MIRT025470	hsa-miR-34a-5p	Proteomics	21566225
MIRT027176	hsa-miR-103a-3p	Sequencing	20371350
MIRT030873	hsa-miR-21-5p	Microarray	18591254
MIRT031322	hsa-miR-18a-5p	Sequencing	20371350
MIRT031832	hsa-miR-16-5p	Proteomics	18668040
MIRT046473	hsa-miR-15b-5p	CLASH	23622248
MIRT044934	hsa-miR-186-5p	CLASH	23622248
MIRT042131	hsa-miR-484	CLASH	23622248
MIRT894169	hsa-miR-1197	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT894171	hsa-miR-1276	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894173	hsa-miR-151-3p	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894181	hsa-miR-3117-3p	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894185	hsa-miR-4263	CLIP-seq
MIRT894186	hsa-miR-4311	CLIP-seq
MIRT894187	hsa-miR-4463	CLIP-seq
MIRT894188	hsa-miR-4468	CLIP-seq
MIRT894189	hsa-miR-4496	CLIP-seq
MIRT894190	hsa-miR-4499	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT894194	hsa-miR-486-3p	CLIP-seq
MIRT894195	hsa-miR-488	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894201	hsa-miR-520d-5p	CLIP-seq
MIRT894202	hsa-miR-524-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT894204	hsa-miR-576-5p	CLIP-seq
MIRT894205	hsa-miR-583	CLIP-seq
MIRT894206	hsa-miR-590-3p	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894188	hsa-miR-4468	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT894194	hsa-miR-486-3p	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT894172	hsa-miR-1286	CLIP-seq
MIRT894174	hsa-miR-15a	CLIP-seq
MIRT894175	hsa-miR-15b	CLIP-seq
MIRT894176	hsa-miR-16	CLIP-seq
MIRT894177	hsa-miR-195	CLIP-seq
MIRT894178	hsa-miR-214	CLIP-seq
MIRT894179	hsa-miR-2278	CLIP-seq
MIRT1965133	hsa-miR-2681	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894182	hsa-miR-3619-5p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894184	hsa-miR-424	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT1965134	hsa-miR-4659a-5p	CLIP-seq
MIRT1965135	hsa-miR-4659b-5p	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT894193	hsa-miR-4777-5p	CLIP-seq
MIRT1965136	hsa-miR-485-3p	CLIP-seq
MIRT894196	hsa-miR-497	CLIP-seq
MIRT894197	hsa-miR-518d-5p	CLIP-seq
MIRT894198	hsa-miR-519b-5p	CLIP-seq
MIRT894199	hsa-miR-519c-5p	CLIP-seq
MIRT894200	hsa-miR-520c-5p	CLIP-seq
MIRT894203	hsa-miR-526a	CLIP-seq
MIRT1965137	hsa-miR-586	CLIP-seq
MIRT894207	hsa-miR-761	CLIP-seq
MIRT1965136	hsa-miR-485-3p	CLIP-seq
MIRT894183	hsa-miR-3660	CLIP-seq
MIRT894191	hsa-miR-4526	CLIP-seq
MIRT2503887	hsa-miR-1224-5p	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT2503888	hsa-miR-1245b-5p	CLIP-seq
MIRT894171	hsa-miR-1276	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT894181	hsa-miR-3117-3p	CLIP-seq
MIRT2503889	hsa-miR-3142	CLIP-seq
MIRT2503890	hsa-miR-3149	CLIP-seq
MIRT2503891	hsa-miR-370	CLIP-seq
MIRT894185	hsa-miR-4263	CLIP-seq
MIRT2503892	hsa-miR-4304	CLIP-seq
MIRT894186	hsa-miR-4311	CLIP-seq
MIRT894189	hsa-miR-4496	CLIP-seq
MIRT2503893	hsa-miR-4649-3p	CLIP-seq
MIRT2503894	hsa-miR-4663	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT2503895	hsa-miR-4751	CLIP-seq
MIRT2503896	hsa-miR-4789-5p	CLIP-seq
MIRT894195	hsa-miR-488	CLIP-seq
MIRT2503897	hsa-miR-568	CLIP-seq
MIRT894204	hsa-miR-576-5p	CLIP-seq
MIRT894205	hsa-miR-583	CLIP-seq
MIRT2503887	hsa-miR-1224-5p	CLIP-seq
MIRT894170	hsa-miR-1227	CLIP-seq
MIRT2503888	hsa-miR-1245b-5p	CLIP-seq
MIRT894180	hsa-miR-3064-3p	CLIP-seq
MIRT2503889	hsa-miR-3142	CLIP-seq
MIRT2503890	hsa-miR-3149	CLIP-seq
MIRT2503891	hsa-miR-370	CLIP-seq
MIRT2503892	hsa-miR-4304	CLIP-seq
MIRT2503893	hsa-miR-4649-3p	CLIP-seq
MIRT2503894	hsa-miR-4663	CLIP-seq
MIRT894192	hsa-miR-4704-5p	CLIP-seq
MIRT2503895	hsa-miR-4751	CLIP-seq
MIRT2503896	hsa-miR-4789-5p	CLIP-seq
MIRT2503897	hsa-miR-568	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	25596274
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	21646404
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	11903063, 14603251, 15703215, 17474147, 20360068, 21297582, 26496610, 33961781
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	15703215
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	14718566, 21399614, 21646404
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0007019	Process	Microtubule depolymerization	TAS	26323690
GO:0007051	Process	Spindle organization	IEA
GO:0007051	Process	Spindle organization	IMP	14718566
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007098	Process	Centrosome cycle	IMP	14718566
GO:0007098	Process	Centrosome cycle	IMP	14718566
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	10770946
GO:0015630	Component	Microtubule cytoskeleton	ISS	15703215
GO:0015631	Function	Tubulin binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IBA
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IEA
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IMP	14718566
GO:0032991	Component	Protein-containing complex	IDA	18468998
GO:0035371	Component	Microtubule plus-end	IBA
GO:0035371	Component	Microtubule plus-end	IDA	21646404
GO:0036064	Component	Ciliary basal body	IDA
GO:0043021	Function	Ribonucleoprotein complex binding	IDA	15703215
GO:0043933	Process	Protein-containing complex organization	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046785	Process	Microtubule polymerization	IBA
GO:0046785	Process	Microtubule polymerization	IEA
GO:0046785	Process	Microtubule polymerization	TAS	26323690
GO:0050658	Process	RNA transport	ISS	15703215
GO:0051010	Function	Microtubule plus-end binding	IEA
GO:0051298	Process	Centrosome duplication	IBA
GO:0051301	Process	Cell division	IEA
GO:0061863	Function	Microtubule plus end polymerase	IBA
GO:0061863	Function	Microtubule plus end polymerase	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0090063	Process	Positive regulation of microtubule nucleation	IDA	26414402

MIM	HGNC	e!Ensembl
611142	28959	ENSG00000175216

Q14008

Protein name

Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG)

Protein function

Binds to the plus end of microtubules and regulates microtubule dynamics and microtubule organization. Acts as a processive microtubule polymerase. Promotes cytoplasmic microtubule nucleation and elongation. Plays a major role in organizing spin

PDB

4QMI , 4QMJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02985	HEAT	440 → 470	HEAT repeat	Repeat
PF12348	CLASP_N	856 → 1075	CLASP N terminal	Family
PF12348	CLASP_N	1231 → 1425	CLASP N terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in hepatomas and colonic tumors. Also expressed in skeletal muscle, brain, heart, placenta, lung, liver, kidney and pancreas. Expression is elevated in the brain; highly expressed in the Purkinje cell bodies of the cerebe

Sequence

MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDS
NAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIE
KGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAV
RDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEA
KLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEAL
ESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAG
HVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI
ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLA
DVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKP
GPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVL
PPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQM
KLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVV
SMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLG
VMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE
PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGE
LPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAA
ALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCV
PHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNM
PAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQ
GKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQM
SSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV
LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVY
PASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDN
AVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQ
RAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRC
EMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQA
LTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGN
MISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD
QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFM
KVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKH
SMDQTGSKSDKETEKGASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKY
SDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVS
SIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLTSLLSKPAVPTVASSTDMLHS
KLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSSRK

Sequence length

2032

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane RHO GTPases Activate Formins Mitotic Prometaphase AURKA Activation by TPX2 EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEUPLOIDY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOMAL INSTABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	33540684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	28101582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Stimulate	10766876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	31058365	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	14749730	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	22147262	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26497677	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia Disorganized	Associate	14749730	★★★★★ ★☆☆☆☆ Found in Text Mining only

CKAP5 (cytoskeleton associated protein 5)