Gene Gene information from NCBI Gene database.
Entrez ID 9791
Gene name Phosphatidylserine synthase 1
Gene symbol PTDSS1
Synonyms (NCBI Gene)
LMHDPSS1PSSA
Chromosome 8
Chromosome location 8q22.1
Summary The protein encoded by this gene catalyzes the formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes to the mitochondria-associated membrane of the endoplasmic reticulum, where it serves
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs587777088 A>G Pathogenic Missense variant, coding sequence variant
rs587777089 C>T Pathogenic Missense variant, coding sequence variant
rs587777090 T>C Pathogenic Missense variant, coding sequence variant
rs1057521718 A>G,T Likely-pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
211
miRTarBase ID miRNA Experiments Reference
MIRT037324 hsa-miR-877-5p CLASH 23622248
MIRT617521 hsa-miR-4789-3p HITS-CLIP 23824327
MIRT617520 hsa-miR-4643 HITS-CLIP 23824327
MIRT617519 hsa-miR-1304-3p HITS-CLIP 23824327
MIRT617518 hsa-miR-942-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane ISS
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006629 Process Lipid metabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612792 9587 ENSG00000156471
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P48651
Protein name Phosphatidylserine synthase 1 (PSS-1) (PtdSer synthase 1) (EC 2.7.8.29) (Serine-exchange enzyme I)
Protein function Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine (PubMed:19014349, PubMed:24241535). Catalyzes mainly the conversion of phosphatidylcholine (Pub
PDB 9B4E , 9B4F , 9B4G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03034 PSS 96 372 Phosphatidyl serine synthase Family
Sequence
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTR
DDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLF
LNFEQVKSLMYWLDPNLRYATREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKA
LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFL
EMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQLT
ELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVI
GFLEAIVCIKFG
QDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECE
DGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
Sequence length 473
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Metabolic pathways
  Synthesis of PS
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
35
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lenz-Majewski hyperostosis syndrome Likely pathogenic; Pathogenic rs1811091915, rs587777088, rs587777089, rs587777090, rs1131691429 RCV001328789
RCV000083280
RCV000083281
RCV000083282
RCV001253177
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs961076, rs200369557 RCV005918085
RCV005935031
Cholangiocarcinoma Benign rs961076 RCV005918089
Gastric cancer Benign rs961076 RCV005918087
Hepatocellular carcinoma Benign rs3735987 RCV005922063
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 26742492
Autistic Disorder Associate 26742492
Bone Malalignment Associate 40524567
Cutis Laxa Associate 40524567
Developmental Disabilities Associate 35224839
Ear Diseases Associate 40524567
Gait Disorders Neurologic Associate 40524567
Lenz Majewski hyperostotic dwarfism Associate 35224839, 38262577
Neoplasms Associate 28753886, 35503998, 37489460
Short Rib Polydactyly Syndrome Associate 27044099, 34516042, 37714410, 40524567