Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9791
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylserine synthase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PTDSS1
Synonyms (NCBI Gene) Gene synonyms aliases
LMHD, PSS1, PSSA
Disease Acronyms (UniProt) Disease acronyms from UniProt database
LMHD, PSS1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes to the mitochondria-associated membrane of the endoplasmic reticulum, where it serves
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777088 A>G Pathogenic Missense variant, coding sequence variant
rs587777089 C>T Pathogenic Missense variant, coding sequence variant
rs587777090 T>C Pathogenic Missense variant, coding sequence variant
rs1057521718 A>G,T Likely-pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037324 hsa-miR-877-5p CLASH 23622248
MIRT617521 hsa-miR-4789-3p HITS-CLIP 23824327
MIRT617520 hsa-miR-4643 HITS-CLIP 23824327
MIRT617519 hsa-miR-1304-3p HITS-CLIP 23824327
MIRT617518 hsa-miR-942-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005789 Component Endoplasmic reticulum membrane ISS
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006659 Process Phosphatidylserine biosynthetic process IDA 19014349
GO:0006659 Process Phosphatidylserine biosynthetic process IEA
GO:0006659 Process Phosphatidylserine biosynthetic process TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612792 9587 ENSG00000156471
Protein
UniProt ID P48651
Protein name Phosphatidylserine synthase 1 (PSS-1) (PtdSer synthase 1) (EC 2.7.8.29) (Serine-exchange enzyme I)
Protein function Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine (PubMed:19014349, PubMed:24241535). Catalyzes mainly the conversion of phosphatidylcholine (Pub
PDB 9B4E , 9B4F , 9B4G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03034 PSS 96 372 Phosphatidyl serine synthase Family
Sequence
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTR
DDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLF
LNFEQVKSLMYWLDPNLRYATREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKA
LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFL
EMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQLT
ELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVI
GFLEAIVCIKFG
QDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECE
DGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
Sequence length 473
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerophospholipid metabolism
Metabolic pathways
  Synthesis of PS
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Cutis laxa Cutis Laxa rs80356758, rs80356750, rs119489101, rs119489102, rs193302865, rs121918374, rs121918375, rs1598354372, rs1371235353, rs1598358449, rs121918376, rs121918377, rs121918378, rs137854453, rs1797225811
View all (31 more)
Unknown
Disease term Disease name Evidence References Source
Specific learning disorder Specific learning disability ClinVar
Huntington Disease Huntington Disease GWAS
Gout Gout GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 26742492
Autistic Disorder Associate 26742492
Bone Malalignment Associate 40524567
Cutis Laxa Associate 40524567
Developmental Disabilities Associate 35224839
Ear Diseases Associate 40524567
Gait Disorders Neurologic Associate 40524567
Lenz Majewski hyperostotic dwarfism Associate 35224839, 38262577
Neoplasms Associate 28753886, 35503998, 37489460
Short Rib Polydactyly Syndrome Associate 27044099, 34516042, 37714410, 40524567