Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	977
Gene name	CD151 molecule (Raph blood group)
Gene symbol	CD151
Synonyms (NCBI Gene)	EBS7GP27MER2PETA-3RAPHSFA1TSPAN24
Chromosome	11
Chromosome location	11p15.5
Summary	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565118389	->G	Pathogenic	Coding sequence variant, frameshift variant

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022976	hsa-miR-124-3p	Microarray	18668037
MIRT052276	hsa-let-7b-5p	CLASH	23622248
MIRT042936	hsa-miR-324-3p	CLASH	23622248
MIRT053753	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	24495805
MIRT053753	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	24495805
MIRT054136	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	25119599
MIRT054136	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	25119599
MIRT054566	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT054566	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	23717581
MIRT022976	hsa-miR-124-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	23816858
MIRT022976	hsa-miR-124-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	23816858
MIRT737177	hsa-miR-199a-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32051735
MIRT873683	hsa-miR-1225-5p	CLIP-seq
MIRT873684	hsa-miR-124	CLIP-seq
MIRT873685	hsa-miR-127-5p	CLIP-seq
MIRT873686	hsa-miR-154	CLIP-seq
MIRT873687	hsa-miR-22	CLIP-seq
MIRT873688	hsa-miR-2355-5p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT873691	hsa-miR-3136-3p	CLIP-seq
MIRT873692	hsa-miR-3170	CLIP-seq
MIRT873693	hsa-miR-3184	CLIP-seq
MIRT873694	hsa-miR-323b-5p	CLIP-seq
MIRT873695	hsa-miR-3622a-3p	CLIP-seq
MIRT873696	hsa-miR-3622b-3p	CLIP-seq
MIRT873697	hsa-miR-3670	CLIP-seq
MIRT873698	hsa-miR-3675-5p	CLIP-seq
MIRT873699	hsa-miR-3921	CLIP-seq
MIRT873700	hsa-miR-423-5p	CLIP-seq
MIRT873701	hsa-miR-4257	CLIP-seq
MIRT873702	hsa-miR-4466	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT873704	hsa-miR-4635	CLIP-seq
MIRT873705	hsa-miR-4649-3p	CLIP-seq
MIRT873706	hsa-miR-4653-5p	CLIP-seq
MIRT873707	hsa-miR-4688	CLIP-seq
MIRT873708	hsa-miR-486-3p	CLIP-seq
MIRT873709	hsa-miR-506	CLIP-seq
MIRT873710	hsa-miR-545	CLIP-seq
MIRT873711	hsa-miR-548aa	CLIP-seq
MIRT873712	hsa-miR-548an	CLIP-seq
MIRT873713	hsa-miR-548p	CLIP-seq
MIRT873714	hsa-miR-584	CLIP-seq
MIRT873715	hsa-miR-615-5p	CLIP-seq
MIRT873716	hsa-miR-675	CLIP-seq
MIRT873717	hsa-miR-933	CLIP-seq
MIRT873718	hsa-miR-103a	CLIP-seq
MIRT873719	hsa-miR-107	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT873721	hsa-miR-1262	CLIP-seq
MIRT873722	hsa-miR-15a	CLIP-seq
MIRT873723	hsa-miR-15b	CLIP-seq
MIRT873724	hsa-miR-16	CLIP-seq
MIRT873725	hsa-miR-195	CLIP-seq
MIRT873726	hsa-miR-3922-5p	CLIP-seq
MIRT873727	hsa-miR-3944-5p	CLIP-seq
MIRT873728	hsa-miR-424	CLIP-seq
MIRT873729	hsa-miR-4259	CLIP-seq
MIRT873730	hsa-miR-4701-3p	CLIP-seq
MIRT873731	hsa-miR-4703-3p	CLIP-seq
MIRT873732	hsa-miR-4708-3p	CLIP-seq
MIRT873733	hsa-miR-4715-5p	CLIP-seq
MIRT873734	hsa-miR-497	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873683	hsa-miR-1225-5p	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT1959167	hsa-miR-128	CLIP-seq
MIRT1959168	hsa-miR-148a	CLIP-seq
MIRT1959169	hsa-miR-148b	CLIP-seq
MIRT1959170	hsa-miR-152	CLIP-seq
MIRT873686	hsa-miR-154	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873688	hsa-miR-2355-5p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959173	hsa-miR-331-3p	CLIP-seq
MIRT1959174	hsa-miR-34a	CLIP-seq
MIRT1959175	hsa-miR-34c-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT873701	hsa-miR-4257	CLIP-seq
MIRT1959177	hsa-miR-4270	CLIP-seq
MIRT1959178	hsa-miR-4436b-3p	CLIP-seq
MIRT1959179	hsa-miR-4441	CLIP-seq
MIRT1959180	hsa-miR-4455	CLIP-seq
MIRT1959181	hsa-miR-449a	CLIP-seq
MIRT1959182	hsa-miR-449b	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT873714	hsa-miR-584	CLIP-seq
MIRT1959185	hsa-miR-609	CLIP-seq
MIRT873717	hsa-miR-933	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT1959167	hsa-miR-128	CLIP-seq
MIRT2196119	hsa-miR-1291	CLIP-seq
MIRT2196120	hsa-miR-134	CLIP-seq
MIRT1959168	hsa-miR-148a	CLIP-seq
MIRT1959169	hsa-miR-148b	CLIP-seq
MIRT1959170	hsa-miR-152	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT2196121	hsa-miR-3118	CLIP-seq
MIRT873690	hsa-miR-3120-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959173	hsa-miR-331-3p	CLIP-seq
MIRT1959174	hsa-miR-34a	CLIP-seq
MIRT1959175	hsa-miR-34c-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT1959177	hsa-miR-4270	CLIP-seq
MIRT1959178	hsa-miR-4436b-3p	CLIP-seq
MIRT1959179	hsa-miR-4441	CLIP-seq
MIRT2196122	hsa-miR-4476	CLIP-seq
MIRT2196123	hsa-miR-4493	CLIP-seq
MIRT1959181	hsa-miR-449a	CLIP-seq
MIRT1959182	hsa-miR-449b	CLIP-seq
MIRT873703	hsa-miR-4519	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT873711	hsa-miR-548aa	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT873720	hsa-miR-1244	CLIP-seq
MIRT1959166	hsa-miR-1256	CLIP-seq
MIRT2196119	hsa-miR-1291	CLIP-seq
MIRT1959171	hsa-miR-1913	CLIP-seq
MIRT1546251	hsa-miR-199b-3p	CLIP-seq
MIRT873689	hsa-miR-2467-3p	CLIP-seq
MIRT1546252	hsa-miR-3129-5p	CLIP-seq
MIRT1959172	hsa-miR-3173-5p	CLIP-seq
MIRT1959176	hsa-miR-3545-5p	CLIP-seq
MIRT873729	hsa-miR-4259	CLIP-seq
MIRT873731	hsa-miR-4703-3p	CLIP-seq
MIRT873733	hsa-miR-4715-5p	CLIP-seq
MIRT1546253	hsa-miR-4797-3p	CLIP-seq
MIRT1959183	hsa-miR-510	CLIP-seq
MIRT1959184	hsa-miR-512-5p	CLIP-seq
MIRT1546254	hsa-miR-936	CLIP-seq
MIRT2499222	hsa-miR-3127-3p	CLIP-seq
MIRT2499223	hsa-miR-4256	CLIP-seq
MIRT2499222	hsa-miR-3127-3p	CLIP-seq
MIRT2499223	hsa-miR-4256	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Activation	20149781

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IDA	17716972, 27993971
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IPI	24220332
GO:0005515	Function	Protein binding	IPI	10811835, 14557253, 14676841, 25416956, 25910212, 29892012, 32296183, 33961781, 35271311
GO:0005604	Component	Basement membrane	IDA	23302890
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9602068
GO:0005886	Component	Plasma membrane	TAS	8627808
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	NAS	9602068
GO:0009986	Component	Cell surface	IDA	17716972
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8627808
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	17716972
GO:0030335	Process	Positive regulation of cell migration	IMP	17716972
GO:0042098	Process	T cell proliferation	IEA
GO:0044319	Process	Wound healing, spreading of cells	IDA	17716972
GO:0044319	Process	Wound healing, spreading of cells	IMP	17716972
GO:0045807	Process	Positive regulation of endocytosis	IDA	17716972
GO:0045807	Process	Positive regulation of endocytosis	IMP	17716972

MIM	HGNC	e!Ensembl
602243	1630	ENSG00000177697

P48509

Protein name

CD151 antigen (GP27) (Membrane glycoprotein SFA-1) (Platelet-endothelial tetraspan antigen 3) (PETA-3) (Tetraspanin-24) (Tspan-24) (CD antigen CD151)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Plays a role in various cellular and molecular mechanism through its asso

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	16 → 247	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes (PubMed:15265795). Acts as a sensitive

Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT
AYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNT
ELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVV
PDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF
TCCLYRSLKLEHY

Sequence length

253

Interactions

View interactions

	Reactome
			Assembly of collagen fibrils and other multimeric structures Type I hemidesmosome assembly

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Epidermolysis bullosa simplex 7, with nephropathy and deafness	Pathogenic; Likely pathogenic	rs1565118389, rs1846753757, rs1846841530	RCV000007805 RCV003222286 RCV003222287

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign; Benign	rs12420593, rs111473261	RCV005917696 RCV005923616
CD151-related disorder	Conflicting classifications of pathogenicity; Likely benign; Benign	rs559057238, rs144204595, rs572689402, rs781747523, rs138746134, rs34726520, rs117252522, rs199816860, rs374490956	RCV003953685 RCV003946271 RCV003906336 RCV003909130 RCV003981747 RCV004758067 RCV004758071 RCV003933153 RCV004758090
Gastric cancer	Likely benign; Uncertain significance	rs34037130, rs750823987, rs374490956	RCV005914525 RCV005920786 RCV005903025
Lung cancer	Likely benign	rs12420593	RCV005917698
Malignant tumor of esophagus	Likely benign	rs12420593	RCV005917697
Ovarian serous cystadenocarcinoma	Likely benign	rs34037130	RCV005914526
RAPH BLOOD GROUP SYSTEM	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	rs192915611, rs35465458, rs141569440, rs777391775, rs371206840, rs146079952, rs370838704, rs200783645, rs770882120, rs375059668, rs143948122, rs199919101, rs560834839, rs753806157, rs887154171 View all (12 more)	RCV002501964 RCV002495977 RCV002484608 RCV002491982 RCV002507024 RCV002506889 RCV005008472 RCV002500047 RCV002505797 RCV002498153 RCV002500398 RCV002500270 RCV005010952 RCV005011024 RCV005008621 RCV005002863 RCV005008684 RCV005008722 RCV005010787 RCV005002913 RCV005010876 RCV005002987 RCV005013007 RCV005003697 RCV005013229 RCV005003737 RCV005013255
Sarcoma	Likely benign; Uncertain significance	rs34037130, rs150909098	RCV005914524 RCV005935022

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	20543560
Adenocarcinoma of Lung	Associate	18492066
Ascites	Associate	36613908
Barrett Esophagus	Associate	20543560
beta Thalassemia	Associate	15265795
Breast Neoplasms	Associate	21505452, 22294188, 22791584, 23717581, 23816858, 26418423, 30468476
Carcinogenesis	Associate	36613908
Carcinoma Hepatocellular	Associate	21961047, 30794666, 37960718
Carcinoma Hepatocellular	Stimulate	28473332
Carcinoma Intraductal Noninfiltrating	Associate	26464707
Carcinoma Lobular	Associate	26418423
Carcinoma Merkel Cell	Associate	20118909
Carcinoma Pancreatic Ductal	Associate	29045505
Carcinoma Renal Cell	Stimulate	21505452
Carcinoma Renal Cell	Associate	35955933
Carcinoma Squamous Cell	Associate	21193415, 27107458
Carcinosarcoma	Associate	21505452
Cell Transformation Neoplastic	Associate	25033048
Chlamydial Pneumonia	Associate	36248887
Cholangiocarcinoma	Associate	20715158
Colorectal Neoplasms	Associate	12838318
Colorectal Neoplasms	Stimulate	34638669
COVID 19	Associate	39374860
Death	Associate	26418423
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	24201754
Endometrial Neoplasms	Associate	21505452
Epidermal Cyst	Associate	16571677, 17632541
Epidermolysis bullosa pretibial	Associate	15265795
Glioblastoma	Stimulate	26992919
Glioma	Associate	26992919
Glomerulonephritis Membranous	Associate	37974210
Glucosephosphate Dehydrogenase Deficiency	Associate	11739177
Hearing Loss Sensorineural	Associate	15265795
Inflammation	Associate	28473332, 32978478
Kidney Failure Chronic	Associate	15265795
Leukemia Megakaryoblastic Acute	Associate	7632941
Leukemia Myeloid	Associate	7632941
Liver Diseases	Stimulate	28473332
Liver Failure	Associate	25033048
Lupus Erythematosus Systemic	Associate	17083624
Lymphatic Metastasis	Associate	20715158
Lymphatic Metastasis	Stimulate	30468476
Lymphoma B Cell	Associate	40464949
Melanoma	Associate	16798740, 22843693
Neoplasm Metastasis	Associate	16798740, 17632541, 20715158, 21961047, 22294188, 24324730, 25119599, 26418423, 28291843
Neoplasm Metastasis	Stimulate	23533596, 30468476
Neoplasms	Associate	16571677, 16798740, 17632541, 20118909, 20715158, 21193415, 21505452, 22294188, 26464707, 26992919, 28276309, 28291843, 28473332, 28954890, 30468476, 35955933, 39294214, 40464949 View all (3 more)
Nephritis Hereditary	Associate	15265795
Osteosarcoma	Associate	20470422
Ovarian Neoplasms	Associate	28273451, 36613908
Prostatic Neoplasms	Associate	22457534, 28291843
Prostatitis	Associate	11988844
Pyloric Atresia	Associate	10811835
Rectal Neoplasms	Associate	16200075
Small Cell Lung Carcinoma	Associate	32586373
Stomach Neoplasms	Associate	23533596, 25119599
Tertiary Lymphoid Structures	Associate	23533596
Triple Negative Breast Neoplasms	Associate	22294188, 34265469, 39294214
Uterine Diseases	Associate	36248887

CD151 (CD151 molecule (Raph blood group))