Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	975
Gene name Gene Name - the full gene name approved by the HGNC.	CD81 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD81
Synonyms (NCBI Gene) Gene synonyms aliases	CVID6, S5.7, TAPA1, TSPAN28
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587776775	G>A	Pathogenic	Splice donor variant

Show/Hide all(187)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020808	hsa-miR-155-5p	Proteomics	18668040
MIRT052151	hsa-let-7b-5p	CLASH	23622248
MIRT039120	hsa-miR-769-3p	CLASH	23622248
MIRT038125	hsa-miR-423-5p	CLASH	23622248
MIRT052737	hsa-miR-1260b	CLASH	23622248
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332487	hsa-miR-3937	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	23446348
MIRT332490	hsa-miR-4672	PAR-CLIP	23446348
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT332490	hsa-miR-4672	PAR-CLIP	23592263
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT180201	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT479637	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT479636	hsa-miR-8080	PAR-CLIP	23592263
MIRT479635	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT180203	hsa-miR-1265	PAR-CLIP	23592263
MIRT180207	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT479634	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT479633	hsa-miR-4493	PAR-CLIP	23592263
MIRT332514	hsa-miR-5702	PAR-CLIP	23592263
MIRT332510	hsa-miR-3152-3p	PAR-CLIP	23592263
MIRT332515	hsa-miR-6126	PAR-CLIP	23592263
MIRT479632	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT180208	hsa-miR-8070	PAR-CLIP	23592263
MIRT732965	hsa-miR-559	qRT-PCR	33788641
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332487	hsa-miR-3937	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT332490	hsa-miR-4672	PAR-CLIP	20371350
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	23446348
MIRT332490	hsa-miR-4672	PAR-CLIP	23446348
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT332492	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT332490	hsa-miR-4672	PAR-CLIP	23592263
MIRT332491	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT479638	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT180201	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT479637	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT479636	hsa-miR-8080	PAR-CLIP	23592263
MIRT479635	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT180203	hsa-miR-1265	PAR-CLIP	23592263
MIRT180207	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT479634	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT479633	hsa-miR-4493	PAR-CLIP	23592263
MIRT332514	hsa-miR-5702	PAR-CLIP	23592263
MIRT332510	hsa-miR-3152-3p	PAR-CLIP	23592263
MIRT332515	hsa-miR-6126	PAR-CLIP	23592263
MIRT479632	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT180208	hsa-miR-8070	PAR-CLIP	23592263
MIRT876217	hsa-miR-194	CLIP-seq
MIRT876218	hsa-miR-2467-3p	CLIP-seq
MIRT876219	hsa-miR-3158-5p	CLIP-seq
MIRT876220	hsa-miR-339-5p	CLIP-seq
MIRT876221	hsa-miR-3646	CLIP-seq
MIRT876222	hsa-miR-3678-3p	CLIP-seq
MIRT876223	hsa-miR-3714	CLIP-seq
MIRT876224	hsa-miR-4257	CLIP-seq
MIRT876225	hsa-miR-4278	CLIP-seq
MIRT876226	hsa-miR-4313	CLIP-seq
MIRT876227	hsa-miR-4418	CLIP-seq
MIRT876228	hsa-miR-4477a	CLIP-seq
MIRT876229	hsa-miR-4669	CLIP-seq
MIRT876230	hsa-miR-4716-3p	CLIP-seq
MIRT876231	hsa-miR-509-3-5p	CLIP-seq
MIRT876232	hsa-miR-509-5p	CLIP-seq
MIRT876233	hsa-miR-548ag	CLIP-seq
MIRT876234	hsa-miR-548ai	CLIP-seq
MIRT876235	hsa-miR-548m	CLIP-seq
MIRT876236	hsa-miR-552	CLIP-seq
MIRT876237	hsa-miR-764	CLIP-seq
MIRT1546287	hsa-miR-1915	CLIP-seq
MIRT876217	hsa-miR-194	CLIP-seq
MIRT1546288	hsa-miR-298	CLIP-seq
MIRT1546289	hsa-miR-3620	CLIP-seq
MIRT1546290	hsa-miR-3649	CLIP-seq
MIRT1546291	hsa-miR-3663-3p	CLIP-seq
MIRT876223	hsa-miR-3714	CLIP-seq
MIRT1546292	hsa-miR-4292	CLIP-seq
MIRT1546293	hsa-miR-4436b-3p	CLIP-seq
MIRT1546294	hsa-miR-4501	CLIP-seq
MIRT1546295	hsa-miR-4685-5p	CLIP-seq
MIRT1546296	hsa-miR-4690-3p	CLIP-seq
MIRT876233	hsa-miR-548ag	CLIP-seq
MIRT876234	hsa-miR-548ai	CLIP-seq
MIRT876235	hsa-miR-548m	CLIP-seq
MIRT876236	hsa-miR-552	CLIP-seq
MIRT876237	hsa-miR-764	CLIP-seq
MIRT1959683	hsa-miR-1237	CLIP-seq
MIRT1959684	hsa-miR-1248	CLIP-seq
MIRT876217	hsa-miR-194	CLIP-seq
MIRT876218	hsa-miR-2467-3p	CLIP-seq
MIRT876219	hsa-miR-3158-5p	CLIP-seq
MIRT1959685	hsa-miR-3607-5p	CLIP-seq
MIRT1546289	hsa-miR-3620	CLIP-seq
MIRT876221	hsa-miR-3646	CLIP-seq
MIRT1546291	hsa-miR-3663-3p	CLIP-seq
MIRT876222	hsa-miR-3678-3p	CLIP-seq
MIRT876223	hsa-miR-3714	CLIP-seq
MIRT876224	hsa-miR-4257	CLIP-seq
MIRT876225	hsa-miR-4278	CLIP-seq
MIRT876226	hsa-miR-4313	CLIP-seq
MIRT1959686	hsa-miR-4326	CLIP-seq
MIRT876227	hsa-miR-4418	CLIP-seq
MIRT876228	hsa-miR-4477a	CLIP-seq
MIRT1546294	hsa-miR-4501	CLIP-seq
MIRT1959687	hsa-miR-4666-5p	CLIP-seq
MIRT876229	hsa-miR-4669	CLIP-seq
MIRT1546296	hsa-miR-4690-3p	CLIP-seq
MIRT876230	hsa-miR-4716-3p	CLIP-seq
MIRT876231	hsa-miR-509-3-5p	CLIP-seq
MIRT876232	hsa-miR-509-5p	CLIP-seq
MIRT876233	hsa-miR-548ag	CLIP-seq
MIRT876234	hsa-miR-548ai	CLIP-seq
MIRT876235	hsa-miR-548m	CLIP-seq
MIRT876236	hsa-miR-552	CLIP-seq
MIRT876237	hsa-miR-764	CLIP-seq
MIRT1546287	hsa-miR-1915	CLIP-seq
MIRT876217	hsa-miR-194	CLIP-seq
MIRT1546288	hsa-miR-298	CLIP-seq
MIRT1959685	hsa-miR-3607-5p	CLIP-seq
MIRT1546290	hsa-miR-3649	CLIP-seq
MIRT1546293	hsa-miR-4436b-3p	CLIP-seq
MIRT1546294	hsa-miR-4501	CLIP-seq
MIRT1546295	hsa-miR-4685-5p	CLIP-seq
MIRT1546296	hsa-miR-4690-3p	CLIP-seq
MIRT876233	hsa-miR-548ag	CLIP-seq
MIRT876234	hsa-miR-548ai	CLIP-seq
MIRT876235	hsa-miR-548m	CLIP-seq
MIRT1959683	hsa-miR-1237	CLIP-seq
MIRT1959684	hsa-miR-1248	CLIP-seq
MIRT1959686	hsa-miR-4326	CLIP-seq
MIRT876221	hsa-miR-3646	CLIP-seq
MIRT876226	hsa-miR-4313	CLIP-seq
MIRT876228	hsa-miR-4477a	CLIP-seq
MIRT2436195	hsa-miR-3160-3p	CLIP-seq
MIRT2436196	hsa-miR-3944-5p	CLIP-seq
MIRT2436197	hsa-miR-4459	CLIP-seq
MIRT2436198	hsa-miR-4487	CLIP-seq
MIRT2436199	hsa-miR-4638-5p	CLIP-seq
MIRT2436200	hsa-miR-4655-5p	CLIP-seq
MIRT2436201	hsa-miR-4722-5p	CLIP-seq
MIRT2436202	hsa-miR-4761-5p	CLIP-seq
MIRT2436203	hsa-miR-4779	CLIP-seq
MIRT2436204	hsa-miR-4792	CLIP-seq
MIRT2436205	hsa-miR-486-3p	CLIP-seq
MIRT2436206	hsa-miR-558	CLIP-seq
MIRT2436207	hsa-miR-624	CLIP-seq
MIRT2436195	hsa-miR-3160-3p	CLIP-seq
MIRT2436196	hsa-miR-3944-5p	CLIP-seq
MIRT2436197	hsa-miR-4459	CLIP-seq
MIRT2436198	hsa-miR-4487	CLIP-seq
MIRT2436199	hsa-miR-4638-5p	CLIP-seq
MIRT2436200	hsa-miR-4655-5p	CLIP-seq
MIRT1546296	hsa-miR-4690-3p	CLIP-seq
MIRT2677771	hsa-miR-4700-3p	CLIP-seq
MIRT2436201	hsa-miR-4722-5p	CLIP-seq
MIRT2436202	hsa-miR-4761-5p	CLIP-seq
MIRT2436203	hsa-miR-4779	CLIP-seq
MIRT2436204	hsa-miR-4792	CLIP-seq
MIRT2436205	hsa-miR-486-3p	CLIP-seq
MIRT2436206	hsa-miR-558	CLIP-seq
MIRT2436207	hsa-miR-624	CLIP-seq

Show/Hide all(70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	IMP	20375010
GO:0001771	Process	Immunological synapse formation	IMP	23858057
GO:0001772	Component	Immunological synapse	IDA	21930792, 23858057
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002455	Process	Humoral immune response mediated by circulating immunoglobulin	IMP	20237408
GO:0002863	Process	Positive regulation of inflammatory response to antigenic stimulus	IEA
GO:0002863	Process	Positive regulation of inflammatory response to antigenic stimulus	ISS
GO:0005178	Function	Integrin binding	IDA	12796480, 27993971
GO:0005515	Function	Protein binding	IPI	2398277, 8409388, 9168119, 9794763, 10400713, 11504738, 12522210, 12604806, 12796480, 14676841, 19088272, 19587294, 20375010, 21930792, 23091066, 23858057, 26354436, 26686862, 26808496, 28871089, 30024968, 32296183, 32900848
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8409388, 14676841, 20237408, 22307619, 26354436
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0008289	Function	Lipid binding	IEA
GO:0009925	Component	Basal plasma membrane	IDA	31791063
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	IEA
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	ISS
GO:0015485	Function	Cholesterol binding	IDA	27881302
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	27881302
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	20375010
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	10400713
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0031647	Process	Regulation of protein stability	IMP	25635054
GO:0031982	Component	Vesicle	IDA	9360996
GO:0034238	Process	Macrophage fusion	IDA	12796480
GO:0034238	Process	Macrophage fusion	IEA
GO:0035783	Process	CD4-positive, alpha-beta T cell costimulation	IDA	22307619
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042289	Function	MHC class II protein binding	IDA	8409388
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	14676841
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	25635054
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050861	Process	Positive regulation of B cell receptor signaling pathway	IEA
GO:0050861	Process	Positive regulation of B cell receptor signaling pathway	IMP	20237408
GO:0050861	Process	Positive regulation of B cell receptor signaling pathway	ISS
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IMP	23858057
GO:0050871	Process	Positive regulation of B cell activation	IEA
GO:0061462	Process	Protein localization to lysosome	IMP	25635054
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15908444, 19028452, 21235781, 21276792, 30871575
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IMP	16449649
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0072659	Process	Protein localization to plasma membrane	IDA	14676841, 27881302
GO:0072659	Process	Protein localization to plasma membrane	IMP	20237408
GO:0072675	Process	Osteoclast fusion	IEA
GO:0072675	Process	Osteoclast fusion	ISS
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	28871089
GO:1903911	Process	Positive regulation of receptor clustering	IDA	23858057
GO:1903911	Process	Positive regulation of receptor clustering	IEA
GO:1904352	Process	Positive regulation of protein catabolic process in the vacuole	IMP	25635054
GO:1905521	Process	Regulation of macrophage migration	IEA
GO:1905521	Process	Regulation of macrophage migration	ISS
GO:1905676	Process	Positive regulation of adaptive immune memory response	IMP	20237408
GO:1990459	Function	Transferrin receptor binding	IPI	25635054
GO:2000145	Process	Regulation of cell motility	IEA
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	IDA	8766544
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	IEA
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	22307619
GO:2001190	Process	Positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	8766544
GO:2001190	Process	Positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA

MIM	HGNC	e!Ensembl
186845	1701	ENSG00000110651

Protein

UniProt ID

P60033

Protein name

CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on th

PDB

1G8Q , 1IV5 , 3X0E , 5DFV , 5DFW , 5M2C , 5M33 , 5M3D , 5M3T , 5M4R , 5TCX , 6EJG , 6EJM , 6EK2 , 6U9S , 7JIC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	10 → 229	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed on B cells (at protein level) (PubMed:20237408). Expressed in hepatocytes (at protein level) (PubMed:12483205). Expressed in monocytes/macrophages (at protein level) (PubMed:12796480). Expressed on both naive and memory CD4-p

Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV
GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA
KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSN
IISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Sequence length

236

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses B cell receptor signaling pathway Malaria Hepatitis C		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Regulation of Complement cascade

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Common variable immunodeficiency	immunodeficiency, common variable, 6	rs587776775	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenomatous Polyposis Coli	Associate	24462038
Anemia Sickle Cell	Associate	23762099
Apical Hypertrophic Cardiomyopathy	Stimulate	35328555
Arthritis Rheumatoid	Associate	36826611
Astrocytoma	Associate	24650279
Autoimmune Diseases	Associate	11985527
Breast Neoplasms	Associate	22791584, 30117494, 35157300, 35579189
Burkitt Lymphoma	Associate	28509416, 9737661
Carcinoma Hepatocellular	Associate	22577054, 29577937, 32322956
Carcinoma Hepatocellular	Inhibit	32350244
Carcinoma Squamous Cell	Associate	34065085
Cirrhosis Familial	Associate	30889491
Colonic Neoplasms	Associate	17959672
Colorectal Neoplasms	Associate	22895844
Common Variable Immunodeficiency	Associate	21905497, 33859323
Congenital thrombotic disease due to Protein C deficiency	Associate	26666746
COVID 19	Associate	37251406
Diabetes Gestational	Associate	35370940
Diabetes Mellitus Type 2	Associate	28254843
Epidermodysplasia Verruciformis	Associate	35012489, 37251406
Epstein Barr Virus Infections	Associate	26498453
Gastrointestinal Neoplasms	Associate	33788641
Glioblastoma	Associate	22672670
Glucosephosphate Dehydrogenase Deficiency	Associate	11739177
Hepatitis B	Associate	16339892
Hepatitis C	Stimulate	11985527, 17177963
Hepatitis C	Associate	12626604, 16339892, 18000990, 19357163, 19780859, 20375010, 22577054, 23954883, 29577937, 32322956
HIV Infections	Associate	17177963, 37404829
Hypoxia	Inhibit	34907783
Hypoxia Brain	Stimulate	24347249
Immunologic Deficiency Syndromes	Associate	20237408
Infections	Associate	11985527, 16461899, 22577054, 23626783, 28871089
Infections	Stimulate	37404829
Inflammation	Associate	27860532, 37443777
Kidney Diseases	Associate	20237408
Leukemia B Cell	Associate	21526201
Leukemia Biphenotypic Acute	Associate	37845689
Leukemia Hairy Cell	Associate	31077558
Leukemia Myeloid Acute	Associate	27566555, 37845689
Leukemia Plasma Cell	Associate	34500493
Lung Neoplasms	Associate	34684727
Lymphatic Metastasis	Stimulate	30117494
Lymphoma	Associate	20004001
Lymphoma B Cell	Associate	24952935, 28509416
Lymphoma Large B Cell Diffuse	Associate	20004001
Lymphoproliferative Disorders	Associate	15956553
Lymphoproliferative Disorders	Stimulate	17177963
Melanoma	Associate	24733393, 27818281, 39222576
Mitochondrial Diseases	Stimulate	26498453
Multiple Myeloma	Associate	19755988, 26666746, 27479184, 30358164, 38280104, 39493694
Neonatal hemochromatosis	Associate	23762099
Neoplasm Metastasis	Associate	24733393
Neoplasms	Associate	19211836, 23264468, 23472067, 29099494, 29577937, 31048929, 32145111, 32350244, 34824296, 35157300, 35328683, 35421932, 36579638, 9403053
Neoplasms Glandular and Epithelial	Stimulate	34898369
Neuroblastoma	Associate	12497591, 23472067
Non Muscle Invasive Bladder Neoplasms	Associate	25915404
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	32926125, 38037221
Pyruvate Carboxylase Deficiency Disease	Associate	27479184, 35886877, 36752202
Respiratory Distress Syndrome	Associate	34898369
Retinoblastoma	Associate	37603355
Sepsis	Associate	17458880, 34898369
Systemic Inflammatory Response Syndrome	Associate	17458880
Urinary Bladder Neoplasms	Associate	25915404, 31501803

CD81 (CD81 molecule)