Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9745
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 536
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF536
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a highly conserved zinc finger protein. The encoded protein is most abundant in brain, where it negatively regulates neuronal differentiation. [provided by RefSeq, Sep 2015]

Show/Hide all(51)

miRTarBase ID	miRNA	Experiments
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2379188	hsa-miR-1304	CLIP-seq
MIRT2379189	hsa-miR-3126-5p	CLIP-seq
MIRT2379190	hsa-miR-3664-3p	CLIP-seq
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2379191	hsa-miR-4419a	CLIP-seq
MIRT2379192	hsa-miR-4510	CLIP-seq
MIRT2379193	hsa-miR-4659a-3p	CLIP-seq
MIRT2379194	hsa-miR-4659b-3p	CLIP-seq
MIRT2379195	hsa-miR-4753-3p	CLIP-seq
MIRT2379196	hsa-miR-510	CLIP-seq
MIRT2379197	hsa-miR-668	CLIP-seq
MIRT2379198	hsa-miR-942	CLIP-seq
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2671271	hsa-miR-1243	CLIP-seq
MIRT2671272	hsa-miR-200b	CLIP-seq
MIRT2671273	hsa-miR-200c	CLIP-seq
MIRT2671274	hsa-miR-3123	CLIP-seq
MIRT2671275	hsa-miR-338-5p	CLIP-seq
MIRT2671276	hsa-miR-3654	CLIP-seq
MIRT2671277	hsa-miR-3675-5p	CLIP-seq
MIRT2671278	hsa-miR-3908	CLIP-seq
MIRT2671279	hsa-miR-3942-5p	CLIP-seq
MIRT2671280	hsa-miR-429	CLIP-seq
MIRT2671281	hsa-miR-4311	CLIP-seq
MIRT2671282	hsa-miR-4434	CLIP-seq
MIRT2671283	hsa-miR-4516	CLIP-seq
MIRT2671284	hsa-miR-4531	CLIP-seq
MIRT2671285	hsa-miR-4703-5p	CLIP-seq
MIRT2671286	hsa-miR-4720-3p	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2671287	hsa-miR-4802-5p	CLIP-seq
MIRT2671288	hsa-miR-4804-3p	CLIP-seq
MIRT2671289	hsa-miR-544	CLIP-seq
MIRT2671290	hsa-miR-642b	CLIP-seq
MIRT2671274	hsa-miR-3123	CLIP-seq
MIRT2671275	hsa-miR-338-5p	CLIP-seq
MIRT2671278	hsa-miR-3908	CLIP-seq
MIRT2671279	hsa-miR-3942-5p	CLIP-seq
MIRT2671281	hsa-miR-4311	CLIP-seq
MIRT2671282	hsa-miR-4434	CLIP-seq
MIRT2671283	hsa-miR-4516	CLIP-seq
MIRT2671284	hsa-miR-4531	CLIP-seq
MIRT2671285	hsa-miR-4703-5p	CLIP-seq
MIRT2671286	hsa-miR-4720-3p	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2671287	hsa-miR-4802-5p	CLIP-seq
MIRT2671288	hsa-miR-4804-3p	CLIP-seq
MIRT2671289	hsa-miR-544	CLIP-seq
MIRT2671290	hsa-miR-642b	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19398580
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19398580
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19398580
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0044323	Function	Retinoic acid-responsive element binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048387	Process	Negative regulation of retinoic acid receptor signaling pathway	IEA

MIM	HGNC	e!Ensembl
618037	29025	ENSG00000198597

Protein

UniProt ID

O15090

Protein name

Zinc finger protein 536

Protein function

Transcriptional repressor that negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription (PubMed:19398580). Binds and interrupts RARA from binding to retinoic acid response elements (RARE) composed of tan

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	130 → 152	Zinc finger, C2H2 type	Domain
PF13909	zf-H2C2_5	158 → 181		Domain
PF00096	zf-C2H2	345 → 367	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	631 → 653	Zinc finger, C2H2 type	Domain
PF16606	zf-C2H2_assoc	657 → 737		Disordered
PF00096	zf-C2H2	752 → 773	Zinc finger, C2H2 type	Domain

Sequence

MEEASLCLGVSSAEPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKP
PASLEEKAHVPMSGQPMGSQMALLANQLGREVDTSLNGRVDLQQFLNGQNLGIMSQMSDI
EDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTH
KLGNLGKGRGRVREENRLLHELEERAILRDKQLKGSLLQPRPDLKPPPHAQQAPLAACTL
ALQANHSVPDVAHPVPSPKPASVQEDAVAPAAGFRCTFCKGKFKKREELDRHIRILHKPY
KCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVCGQVFSQAWFL
KGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ
EAHANLYSRYLSCLQSGFMTPDKAGLSEPSQLYGKGELPMKEKEALGKLLSPISSMAHGV
PEGDKHSLLGCLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSK
EHPLQRNHEDTLANAGVLFDKEKREYVLVGADGSKQKMPADLVHSTKVGSQRDLPSKLDP
LESSRDFLSHGLNQTLEYNLQGPGNMKEKPTECPDCGRVFRTYHQVVVHSRVHKRDRKGE
EDGLHVGLDERRGSGSDQESQSVSRSTTPGSSNVTEESGVGGGLSQTGSAQEDSPHPSSP
SSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHLRIHTGEKPYK
CPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQDHKDEMSSKASLFIRPDILRG
AFKGLPGIDFRGGPASQQWTSGVLSSGDHSGQATGMSSEVPSDALKGTDLPSKSTHFSEI
GRAYQSIVSNGVNFQGSLQAFMDSFVLSSLKKEKDMKDKALADPPSMKVHGVDGGEEKPS
GKSSQRKSEKSQYEPLDLSVRPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHL
QANHLGKAKRKDNTIGVTVNCKDQAREASKMALLPSLQSNKDLGLSNMISSLDSASEKMA
QGQLKETLGEQKSGAWTGHVDPAFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAH
SEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPLSALSKD
SSSDGGDSLQPTGTSQPVQGLVSPLSQAPEKQWHSQGLLQAQDPLAGLPKPERGPQSLDK
PMNMLSVLRAYSSDGLAAFNGLASSTANSGCIKRPDLCGK

Sequence length

1300

Interactions

View interactions

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Hypertension	Hypertensive disease	rs13306026	26516778
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)	31220337
Myopia	Myopia, Degenerative	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805 View all (6 more)	23049088
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	23797736
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	23797736
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	31268507, 25056061, 26198764, 29483656, 28991256, 30285260

Show/Hide Unknown Diseases (8)

Disease term	Disease name	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	23797736	ClinVar
Mental depression	Major Depressive Disorder	30718901	ClinVar
Myocardial infarction	Myocardial Infarction	26516778	ClinVar
Metabolic Syndrome	Metabolic Syndrome		GWAS
Mental Depression	Mental Depression		GWAS
Insomnia	Insomnia		GWAS
Diabetes	Diabetes		GWAS
Ischemic Stroke	Ischemic Stroke		GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Attention Deficit Disorder with Hyperactivity	Associate	34573389
Autism Spectrum Disorder	Associate	37280359
Body Weight	Associate	34573389
Neoplasms	Associate	37460928

ZNF536 (zinc finger protein 536)