Gene Gene information from NCBI Gene database.
Entrez ID 9738
Gene name Centriolar coiled-coil protein 110
Gene symbol CCP110
Synonyms (NCBI Gene)
CP110Cep110
Chromosome 16
Chromosome location 16p12.3
miRNA miRNA information provided by mirtarbase database.
325
miRTarBase ID miRNA Experiments Reference
MIRT006725 hsa-miR-129-2-3p Luciferase reporter assayqRT-PCRWestern blot 22684256
MIRT016275 hsa-miR-193b-3p Microarray 20304954
MIRT659703 hsa-miR-500a-5p HITS-CLIP 23824327
MIRT659701 hsa-miR-6734-3p HITS-CLIP 23824327
MIRT659702 hsa-miR-3667-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12361598, 16760425, 17719545, 18694559, 19460342, 20596027, 21620453, 22441691, 22632967, 23486064, 24421332, 24981860, 26638075, 27173435, 30375385, 33961781, 35709258
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 12361598, 16760425, 21399614, 22684256, 30375385
GO:0005813 Component Centrosome IEA
GO:0005814 Component Centriole IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609544 24342 ENSG00000103540
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43303
Protein name Centriolar coiled-coil protein of 110 kDa (Centrosomal protein of 110 kDa) (CP110) (Cep110)
Protein function Necessary for centrosome duplication at different stages of procentriole formation. Acts as a key negative regulator of ciliogenesis in collaboration with CEP97 by capping the mother centriole thereby preventing cilia formation (PubMed:17681131,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16025 CALM_bind 29 106 Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:12361598}.
Sequence
MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEK
QKALDVEARKQVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEME
TVYSNSEVRNLNVP
ATFPNSFPSHTEHSTAAKLDKIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNIS
HVENEAFPKTSSATPQETLISDGPFSVNEQQDLPLLAEVIPDPYVMSLQNLMKKSKEYIE
REQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQLTGKHCVSVIPDKPSLNKSNV
LLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGS
YAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTV
EGQLTSDERGAHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTE
LNKSYDVKNPSPLLMQNQNTRQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENC
PYVITSGITEQERQHLPEKRYPKGSGFVNKNKMLGTSSKESEELLKSKMLAFEEMRKRLE
EQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTAEASELDINNAVELEWRKISD
SSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSGLTKLSVTRPF
GRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQ
MDKMKSPRVALSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVH
RLLSRQGTPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI
Sequence length 1012
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
Ub-specific processing proteases
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CILIOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Dykes Markes Harper syndrome Associate 33491601
★☆☆☆☆
Found in Text Mining only
Fatigue Associate 33491601
★☆☆☆☆
Found in Text Mining only
Holoprosencephaly recurrent infections and monocytosis Associate 33491601
★☆☆☆☆
Found in Text Mining only
Infections Associate 29724823
★☆☆☆☆
Found in Text Mining only
Leukocytosis Associate 33491601
★☆☆☆☆
Found in Text Mining only
Lymphoma Associate 33491601
★☆☆☆☆
Found in Text Mining only
Myeloproliferative Disorders Associate 25803811, 28242791
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 28242791
★☆☆☆☆
Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 33491601
★☆☆☆☆
Found in Text Mining only
Tonsillitis Associate 33491601
★☆☆☆☆
Found in Text Mining only