CD74 (CD74 molecule)

Gene

• Entrez ID: 972
• Gene name: CD74 molecule
• Gene symbol: CD74
• Synonyms (NCBI Gene): CLIP, DHLAG, HLADG, II, Ia-GAMMA, p33
• Chromosome: 5
• Chromosome location: 5q33.1
• Summary: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage mig

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT876159	hsa-miR-1276	CLIP-seq
MIRT876160	hsa-miR-4269	CLIP-seq
MIRT876161	hsa-miR-4645-5p	CLIP-seq
MIRT876162	hsa-miR-4673	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT876164	hsa-miR-4755-3p	CLIP-seq
MIRT1546272	hsa-miR-1205	CLIP-seq
MIRT1546273	hsa-miR-2110	CLIP-seq
MIRT1546274	hsa-miR-24	CLIP-seq
MIRT1546275	hsa-miR-3121-3p	CLIP-seq
MIRT1546276	hsa-miR-3153	CLIP-seq
MIRT1546277	hsa-miR-3665	CLIP-seq
MIRT1546278	hsa-miR-4271	CLIP-seq
MIRT1546279	hsa-miR-4284	CLIP-seq
MIRT1546280	hsa-miR-4667-5p	CLIP-seq
MIRT1546281	hsa-miR-4693-3p	CLIP-seq
MIRT1546282	hsa-miR-4700-5p	CLIP-seq
MIRT1546283	hsa-miR-4725-3p	CLIP-seq
MIRT1546284	hsa-miR-4731-5p	CLIP-seq
MIRT1546285	hsa-miR-596	CLIP-seq
MIRT1546286	hsa-miR-657	CLIP-seq
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT2196686	hsa-miR-3135b	CLIP-seq
MIRT2196687	hsa-miR-3175	CLIP-seq
MIRT2196688	hsa-miR-3652	CLIP-seq
MIRT2196689	hsa-miR-4430	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT2385778	hsa-let-7a	CLIP-seq
MIRT2385779	hsa-let-7b	CLIP-seq
MIRT2385780	hsa-let-7c	CLIP-seq
MIRT2385781	hsa-let-7d	CLIP-seq
MIRT2385782	hsa-let-7e	CLIP-seq
MIRT2385783	hsa-let-7f	CLIP-seq
MIRT2385784	hsa-let-7g	CLIP-seq
MIRT2385785	hsa-let-7i	CLIP-seq
MIRT876158	hsa-miR-1182	CLIP-seq
MIRT2385786	hsa-miR-1236	CLIP-seq
MIRT2385787	hsa-miR-1255a	CLIP-seq
MIRT2385788	hsa-miR-1255b	CLIP-seq
MIRT2385789	hsa-miR-1273f	CLIP-seq
MIRT2385790	hsa-miR-202	CLIP-seq
MIRT1546273	hsa-miR-2110	CLIP-seq
MIRT2385791	hsa-miR-3150a-3p	CLIP-seq
MIRT1546276	hsa-miR-3153	CLIP-seq
MIRT2196687	hsa-miR-3175	CLIP-seq
MIRT2385792	hsa-miR-3189-3p	CLIP-seq
MIRT1546278	hsa-miR-4271	CLIP-seq
MIRT2385793	hsa-miR-4458	CLIP-seq
MIRT2385794	hsa-miR-4500	CLIP-seq
MIRT1546280	hsa-miR-4667-5p	CLIP-seq
MIRT1546282	hsa-miR-4700-5p	CLIP-seq
MIRT1546283	hsa-miR-4725-3p	CLIP-seq
MIRT1546284	hsa-miR-4731-5p	CLIP-seq
MIRT876163	hsa-miR-4733-3p	CLIP-seq
MIRT2385795	hsa-miR-4765	CLIP-seq
MIRT2385796	hsa-miR-502-5p	CLIP-seq
MIRT2385797	hsa-miR-760	CLIP-seq
MIRT2385798	hsa-miR-939	CLIP-seq
MIRT2385799	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	8164652
RELA	Unknown	8164652

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	12782713
GO:0001540	Function	Amyloid-beta binding	IPI	19849849
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IBA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IEA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IMP	12782713
GO:0002250	Process	Adaptive immune response	IEA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	IEA
GO:0002792	Process	Negative regulation of peptide secretion	IDA	19849849
GO:0002830	Process	Positive regulation of type 2 immune response	IBA
GO:0002830	Process	Positive regulation of type 2 immune response	IEA
GO:0002906	Process	Negative regulation of mature B cell apoptotic process	IEA
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IDA	17045821
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17357109, 17435771, 19665027, 29190904, 30833792, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	19423618
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22952837, 24569872
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005771	Component	Multivesicular body	IEA
GO:0005773	Component	Vacuole	IDA	19849849
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	19665027, 22952837, 24569872
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	17045821, 19665027, 22952837
GO:0010628	Process	Positive regulation of gene expression	IMP	19423618
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	12782713
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	ISS
GO:0019882	Process	Antigen processing and presentation	IBA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019883	Process	Antigen processing and presentation of endogenous antigen	NAS	10981873
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0019955	Function	Cytokine binding	IEA
GO:0019955	Function	Cytokine binding	IPI	17567581
GO:0023026	Function	MHC class II protein complex binding	IDA	1448172
GO:0030336	Process	Negative regulation of cell migration	IMP	20198449, 22952837
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	12782713
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IMP	24569872
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032722	Process	Positive regulation of chemokine production	IMP	19423618
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	24569872
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	24569872
GO:0032991	Component	Protein-containing complex	IDA	19665027
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0034341	Process	Response to type II interferon	IDA	32855215
GO:0034341	Process	Response to type II interferon	IEA
GO:0035691	Process	Macrophage migration inhibitory factor signaling pathway	IEA
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IDA	17045821
GO:0035692	Component	Macrophage migration inhibitory factor receptor complex	IEA
GO:0035693	Component	NOS2-CD74 complex	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IBA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IEA
GO:0035718	Function	Macrophage migration inhibitory factor binding	IPI	17045821
GO:0042289	Function	MHC class II protein binding	IBA
GO:0042289	Function	MHC class II protein binding	IEA
GO:0042289	Function	MHC class II protein binding	ISS
GO:0042289	Function	MHC class II protein binding	NAS	10981873
GO:0042609	Function	CD4 receptor binding	IPI	24942581
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	ISS
GO:0042658	Function	MHC class II protein binding, via antigen binding groove	IDA	7477400
GO:0042802	Function	Identical protein binding	TAS	12782713
GO:0043030	Process	Regulation of macrophage activation	NAS	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12782713
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24942581
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IBA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0044183	Function	Protein folding chaperone	IDA	7477400
GO:0045058	Process	T cell selection	NAS	10981873
GO:0045059	Process	Positive thymic T cell selection	IEA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045581	Process	Negative regulation of T cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24942581
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	32855215
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	12782713
GO:0050821	Process	Protein stabilization	ISS
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IBA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070206	Process	Protein trimerization	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17045821, 24942581
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	12782713
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	17045821
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS
GO:2000448	Process	Positive regulation of macrophage migration inhibitory factor signaling pathway	IMP	19665027

Other IDs

• MIM: 142790
• HGNC: 1697
• e!Ensembl: ENSG00000019582

Protein

• UniProt ID: P04233
• Protein name: HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide (CLIP)]
• Protein function: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/
• PDB: 1A6A, 1ICF, 1IIE, 1L3H, 1MUJ, 3PDO, 3PGC, 3PGD, 3QXA, 3QXD, 4AEN, 4AH2, 4X5W, 5KSU, 5KSV, 7YX9, 7YXB, 7Z0Q, 8VRW, 8VSJ, 8VSP, 9CYL, 9CYM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09307	MHC2-interact	17 → 129	CLIP, MHC2 interacting	Domain
  PF08831	MHCassoc_trimer	136 → 204	Class II MHC-associated invariant chain trimerisation domain	Domain
  PF00086	Thyroglobulin_1	208 → 271	Thyroglobulin type-1 repeat	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [Isoform p41]: In B cells, represents 10% of total CD74 expression. {ECO:0000269|PubMed
• Sequence:

  MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
  LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
  GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
  FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
  LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

• Sequence length: 296

Pathways

KEGG:

Antigen processing and presentation
Tuberculosis
Herpes simplex virus 1 infection

Reactome:

Cell surface interactions at the vascular wall
MHC class II antigen presentation

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Acute myeloid leukemia	Likely benign	rs142001873	RCV005927403
Cervical cancer	Likely benign	rs142001873	RCV005927405
Colon adenocarcinoma	Likely benign	rs142001873	RCV005927402
Colorectal cancer	Likely benign	rs142001873	RCV005927406
Familial cancer of breast	Likely benign	rs142001873	RCV005927401
Gastric cancer	Likely benign	rs142001873	RCV005927408
Lung cancer	Likely benign	rs142001873	RCV005927411
Nonpapillary renal cell carcinoma	Likely benign	rs142001873	RCV005927404
Ovarian serous cystadenocarcinoma	Likely benign	rs142001873	RCV005927409
Sarcoma	Likely benign	rs142001873	RCV005927407
Thyroid cancer, nonmedullary, 1	Likely benign	rs142001873	RCV005927410
Uterine corpus endometrial carcinoma	Likely benign	rs142001873	RCV005927412

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Kidney Injury	Associate	39616313
Adenocarcinoma	Associate	26837769
Adenocarcinoma Mucinous	Associate	26837769
Adenocarcinoma of Lung	Associate	23724914, 25567908, 26486077, 26673800, 29858224, 32036070, 33000474, 33839701, 33945921, 34319660, 36096509
Alzheimer Disease	Associate	33081847
Aortic Valve Stenosis	Associate	37175670
Arthritis Juvenile	Associate	29848367
Atherosclerosis	Associate	37508563
Bile Duct Diseases	Associate	40596471
Bone Diseases Metabolic	Associate	25565391
Brain Neoplasms	Associate	29490700, 34209696
Breast Neoplasms	Associate	22935920, 23730214, 24939415, 27058619, 27626171, 29099283, 32305991
Bronchopulmonary Dysplasia	Associate	33235138
Carcinogenesis	Associate	24939415, 27626171, 35208514, 35769782, 37880655
Carcinoma	Associate	28114961
Carcinoma Hepatocellular	Associate	34009409
Carcinoma Intraductal Noninfiltrating	Associate	27247112
Carcinoma Non Small Cell Lung	Associate	19131591, 34051833, 34132450, 35135829, 37727007, 38070598, 38148635
Carcinoma Pancreatic Ductal	Associate	37629174, 37653101
Carcinoma Renal Cell	Associate	30838877
Carcinoma Squamous Cell	Associate	21792010
Carcinoma Squamous Cell	Stimulate	35208514
Cardiovascular Diseases	Associate	31611368
Cerebral Infarction	Associate	27884769
Chromosome 8 trisomy	Stimulate	38299667
Colonic Diseases	Associate	21228923
Colonic Neoplasms	Associate	21228923, 32521887
Colorectal Neoplasms	Associate	21228923, 28114961, 39824178
COVID 19	Associate	34137173, 35421082, 37946732, 40163554
Crohn Disease	Stimulate	37818353
Death	Associate	22977190
Diabetes Mellitus	Associate	18842989
Diabetes Mellitus Type 1	Associate	23637351, 37576973
Diabetes Mellitus Type 2	Stimulate	18842989, 36527108
Diabetic Nephropathies	Stimulate	18842989
Disease	Associate	29848367
Drug Related Side Effects and Adverse Reactions	Associate	37946732
Endometrial Neoplasms	Stimulate	25439837
Endometrial Neoplasms	Associate	33159014
Endplate Acetylcholinesterase Deficiency	Associate	39271714
Epstein Barr Virus Infections	Inhibit	25631773
Fatigue Syndrome Chronic	Associate	39394558
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	26125927
Gastrointestinal Neoplasms	Associate	21228923
Glioblastoma	Associate	25175718
Glioma	Associate	25175718
Glomerulonephritis	Associate	33754492
Heart Failure	Associate	38169915
Hematologic Neoplasms	Associate	25175718
Histiocytosis Langerhans Cell	Associate	36714021
Hodgkin Disease	Associate	30191677
Hypersplenism	Associate	35865544
Immunologic Deficiency Syndromes	Associate	25565391
Inflammation	Associate	19921347, 24569872, 25439837, 26783288, 29487601, 31866994, 32198923, 37508563, 37629174, 37776766, 40596471
Inflammation	Stimulate	38169915
Inflammatory Breast Neoplasms	Associate	34051833
Intervertebral Disc Degeneration	Associate	22952837
Kidney Diseases	Associate	39616313
Leprosy Lepromatous	Stimulate	29487601
Leukemia Lymphocytic Chronic B Cell	Stimulate	23572149
Leukemia Lymphocytic Chronic B Cell	Associate	36323260
Leukemia Myeloid Acute	Associate	26246143, 29286103, 31105032, 38299667
Leukemia Plasma Cell	Associate	30191677
Liver Cirrhosis Biliary	Associate	23913513
Liver Cirrhosis Biliary	Stimulate	40596471
Lung Diseases Interstitial	Associate	25052332
Lung Neoplasms	Associate	24759083, 26837769, 32852072
Lupus Erythematosus Systemic	Associate	29070082, 39290707
Lymphatic Metastasis	Stimulate	22611320
Lymphatic Metastasis	Associate	22935920, 32521887
Lymphoma	Associate	30191677
Lymphoma B Cell	Associate	30191677
Lymphoma B Cell Marginal Zone	Associate	22110251
Lymphoma Extranodal NK T Cell	Associate	30191677
Lymphoma Large B Cell Diffuse	Associate	26500140, 39376717
Lymphoma Mantle Cell	Associate	22361516
Lymphoma Non Hodgkin	Associate	17659054, 36945359
Lymphoma T Cell	Associate	30191677
Melanoma	Associate	26783288, 31069878, 33344042
Melanoma Cutaneous Malignant	Associate	36466837
Meningioma	Associate	37880655
Mesothelioma Malignant	Associate	24594996, 37147569
Mouth Diseases	Associate	21228923
Moyamoya Disease	Associate	39290707
Mucocutaneous Lymph Node Syndrome	Associate	28707750
Multiple Myeloma	Associate	30191677, 35145037, 38035078
Multiple Sclerosis	Inhibit	30160778
Muscle Neoplasms	Associate	37508563
Myopathies Structural Congenital	Associate	39457004
Myopathy with Giant Abnormal Mitochondria	Associate	28114961
Myositis Inclusion Body	Associate	32259312, 37153570
Neoplasm Metastasis	Associate	27626171, 28639897, 29490700, 29883837, 31992246, 32591432, 34209696, 38148635
Neoplasms	Associate	11337362, 19602232, 21228923, 21792010, 23572149, 24594996, 25351743, 26206776, 26837769, 27058619, 29045509, 29490700, 30191677, 31817155, 33063451, 35208514, 35509079, 35769782, 36371985, 37335089, 37629174, 37880655, 37974218, 38095640, 38280003
Neoplasms	Stimulate	23730214
Neoplasms	Inhibit	24939415
Nephrotic Syndrome	Associate	35173708
Nerve Sheath Neoplasms	Associate	16406348
Neuroinflammatory Diseases	Associate	35837411
Neurologic Manifestations	Associate	36691005
Osteosarcoma	Associate	29045509, 38256356
Ovarian Neoplasms	Associate	15467430
Pancreatic Neoplasms	Associate	15477757, 21228923, 37629174
Pancreatic Neoplasms	Stimulate	23679566
Pneumonia	Associate	31611368
Sarcoma	Associate	30963193
Sepsis	Associate	39616313
Sjogren's Syndrome	Associate	29070082, 37153570
Spinal Cord Injuries	Associate	35837411
Spondylitis Ankylosing	Associate	32198923
Squamous Cell Carcinoma of Head and Neck	Associate	19602232
Stomach Neoplasms	Associate	22611320, 27323782
Stomach Neoplasms	Stimulate	38319150
Stroke	Associate	27884769
Thyroid Cancer Papillary	Associate	26206776
Thyroid Neoplasms	Associate	26206776
Triple Negative Breast Neoplasms	Associate	22935920, 37963845
Uterine Cervical Dysplasia	Stimulate	35208514
Uterine Cervical Neoplasms	Associate	28639897