Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9705
Gene name Gene Name - the full gene name approved by the HGNC.	ST18 C2H2C-type zinc finger transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ST18
Synonyms (NCBI Gene) Gene synonyms aliases	NZF-3, NZF3, ZC2H2C3, ZC2HC10, ZNF387
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q11.23

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030273	hsa-miR-26b-5p	Microarray	19088304
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT447457	hsa-miR-451b	PAR-CLIP	22100165
MIRT447456	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1393215	hsa-miR-1207-3p	CLIP-seq
MIRT1393216	hsa-miR-1301	CLIP-seq
MIRT1393217	hsa-miR-1973	CLIP-seq
MIRT1393218	hsa-miR-2110	CLIP-seq
MIRT1393219	hsa-miR-3074-3p	CLIP-seq
MIRT1393220	hsa-miR-3667-3p	CLIP-seq
MIRT1393221	hsa-miR-3944-5p	CLIP-seq
MIRT1393222	hsa-miR-4271	CLIP-seq
MIRT1393223	hsa-miR-4660	CLIP-seq
MIRT1393224	hsa-miR-4667-5p	CLIP-seq
MIRT1393225	hsa-miR-4668-5p	CLIP-seq
MIRT1393226	hsa-miR-4700-5p	CLIP-seq
MIRT1393227	hsa-miR-4725-3p	CLIP-seq
MIRT1393228	hsa-miR-4731-5p	CLIP-seq
MIRT1393229	hsa-miR-495	CLIP-seq
MIRT1393230	hsa-miR-5047	CLIP-seq
MIRT2118073	hsa-miR-3180-5p	CLIP-seq
MIRT2118074	hsa-miR-4303	CLIP-seq
MIRT2118075	hsa-miR-4468	CLIP-seq
MIRT2118076	hsa-miR-4687-3p	CLIP-seq
MIRT2118077	hsa-miR-4690-5p	CLIP-seq
MIRT2339982	hsa-miR-2113	CLIP-seq
MIRT2339983	hsa-miR-4698	CLIP-seq
MIRT2339984	hsa-miR-579	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18676404
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15489893
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15489893
GO:0032993	Component	Protein-DNA complex	IDA	18676404
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	18676404
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18676404
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	18676404
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	18676404
GO:2001269	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	18676404

MIM	HGNC	e!Ensembl
617155	18695	ENSG00000147488

Protein

UniProt ID

O60284

Protein name

Suppression of tumorigenicity 18 protein (Zinc finger protein 387)

Protein function

Repressor that binds to DNA sequences containing a bipartite element consisting of a direct repeat of the sequence 5'-AAAGTTT-3' separated by 2-9 nucleotides. Represses basal transcription activity from target promoters (By similarity). Inhibits

PDB

2CS8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01530	zf-C2HC	367 → 394	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	411 → 439	Zinc finger, C2HC type	Family
PF08474	MYT1	478 → 715	Myelin transcription factor 1	Family
PF01530	zf-C2HC	723 → 751	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	767 → 795	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	815 → 843	Zinc finger, C2HC type	Family
PF01530	zf-C2HC	868 → 896	Zinc finger, C2HC type	Family

Tissue specificity

TISSUE SPECIFICITY: Detected at low levels in heart, liver, kidney, skeletal muscle, pancreas, testis, ovary and prostate. Detected at even lower levels in mammary epithelial cells and breast cancer cells. {ECO:0000269|PubMed:15489893}.

Sequence

MDAEAEDKTLRTRSKGTEVPMDSLIQELSVAYDCSMAKKRTAEDQALGVPVNKRKSLLMK
PRHYSPKADCQEDRSDRTEDDGPLETHGHSTAEEIMIKPMDESLLSTAQENSSRKEDRYS
CYQELMVKSLMHLGKFEKNVSVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKID
DSQPPFCSSDDNESNSESAENGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEG
DKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEEEDSESLAVMTEEGSDLEKAK
GNLSLLEQAIALQAERGCVFHNTYKELDRFLLEHLAGERRQTKVIDMGGRQIFNNKHSPR
PEKRETKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGR
GHVNSNRNTHRSLSGCPIAAAEKLAMSQDKNQLDSPQTGQCPDQAHRTSLVKQIEFNFPS
QAITSPRATVSKEQEKFGKVPFDYASFDAQVFGKRPLIQTVQGRKTPPFPESKHFPNPVK
FPNRLPSAGAHTQSPGRASSYSYGQCSEDTHIAAAAAILNLSTRCREATDILSNKPQSLH
AKGAEIEVDENGTLDLSMKKNRILDKSAPLTSSNTSIPTPSSSPFKTSSILVNAAFYQAL
CDQEGWDTPINYSKTHGKTEEEKEKDPVSSLENLEEKKFPGEASIPSPKPKLHARDLKKE
LITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVT
GNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGC
PLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVI
KKGKVSEELMTIKLKATGGIESDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESN
LKTIEEENKLIEQNNESLLKELAGLSQALISSLADIQLPQMGPISEQNFEAYVNTLTDMY
SNLERDYSPECKALLESIKQAVKGIHV

Sequence length

1047

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	23535033
Frontotemporal dementia	Frontotemporal dementia	rs63751273, rs63750376, rs63750424, rs63750972, rs1568327531, rs63750570, rs63750756, rs63751165, rs63750512, rs63751438, rs63750912, rs63750711, rs63750635, rs63750349, rs63750092 View all (31 more)	29724592
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Motion Sickness	Motion Sickness	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	21151896
Alzheimer Disease	Associate	33640202
Atrophy	Associate	33640202
Breast Neoplasms	Inhibit	18676404
Carcinoma Hepatocellular	Associate	33879706
Glaucoma Angle Closure	Associate	23505305, 23847314
Head and Neck Neoplasms	Associate	36010616
Inflammation	Associate	22437316, 27148741
Insulin Resistance	Associate	35836279
Jacobs syndrome	Associate	23847314
Leukemia	Associate	34600138
Leukemia Myeloid Acute	Associate	34600138, 34619772
Microphthalmia Syndromic 10	Associate	33640202
Pemphigus	Associate	22437316, 27148741, 31057535, 35396567
Pemphigus	Stimulate	35396567

ST18 (ST18 C2H2C-type zinc finger transcription factor)