Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9702
Gene name Gene Name - the full gene name approved by the HGNC.	Centrosomal protein 57
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CEP57
Synonyms (NCBI Gene) Gene synonyms aliases	MVA2, PIG8, TSP57
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MVA2
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerizati

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906977	C>A,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant, non coding transcript variant
rs577173144	G>A,C,T	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant, non coding transcript variant
rs771182933	C>A,G,T	Pathogenic, likely-benign	Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, missense variant
rs1166323407	->CAATGTTCAGC	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1555052278	A>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, intron variant
rs1565326373	GA>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, intron variant
rs1590962541	C>-	Likely-pathogenic	Coding sequence variant, stop gained, non coding transcript variant

Show/Hide all(231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039373	hsa-miR-421	CLASH	23622248
MIRT247082	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT247079	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT247082	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT247078	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT247083	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT247080	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT247087	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT247079	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT886141	hsa-miR-106a	CLIP-seq
MIRT886142	hsa-miR-106b	CLIP-seq
MIRT886143	hsa-miR-1178	CLIP-seq
MIRT886144	hsa-miR-1183	CLIP-seq
MIRT886145	hsa-miR-1229	CLIP-seq
MIRT886146	hsa-miR-1305	CLIP-seq
MIRT886147	hsa-miR-141	CLIP-seq
MIRT886148	hsa-miR-150	CLIP-seq
MIRT886149	hsa-miR-17	CLIP-seq
MIRT886150	hsa-miR-188-5p	CLIP-seq
MIRT886151	hsa-miR-200a	CLIP-seq
MIRT886152	hsa-miR-203	CLIP-seq
MIRT886153	hsa-miR-20a	CLIP-seq
MIRT886154	hsa-miR-20b	CLIP-seq
MIRT886155	hsa-miR-216a	CLIP-seq
MIRT886156	hsa-miR-300	CLIP-seq
MIRT886157	hsa-miR-3120-3p	CLIP-seq
MIRT886158	hsa-miR-3177-5p	CLIP-seq
MIRT886159	hsa-miR-3662	CLIP-seq
MIRT886160	hsa-miR-3672	CLIP-seq
MIRT886161	hsa-miR-381	CLIP-seq
MIRT886162	hsa-miR-3942-5p	CLIP-seq
MIRT886163	hsa-miR-3944-5p	CLIP-seq
MIRT886164	hsa-miR-3973	CLIP-seq
MIRT886165	hsa-miR-4270	CLIP-seq
MIRT886166	hsa-miR-4325	CLIP-seq
MIRT886167	hsa-miR-4436b-5p	CLIP-seq
MIRT886168	hsa-miR-4438	CLIP-seq
MIRT886169	hsa-miR-4441	CLIP-seq
MIRT886170	hsa-miR-4477b	CLIP-seq
MIRT886171	hsa-miR-4490	CLIP-seq
MIRT886172	hsa-miR-4687-3p	CLIP-seq
MIRT886173	hsa-miR-4693-5p	CLIP-seq
MIRT886174	hsa-miR-4703-5p	CLIP-seq
MIRT886175	hsa-miR-4713-5p	CLIP-seq
MIRT886176	hsa-miR-4729	CLIP-seq
MIRT886177	hsa-miR-4755-3p	CLIP-seq
MIRT886178	hsa-miR-4766-5p	CLIP-seq
MIRT886179	hsa-miR-498	CLIP-seq
MIRT886180	hsa-miR-519a	CLIP-seq
MIRT886181	hsa-miR-519b-3p	CLIP-seq
MIRT886182	hsa-miR-519c-3p	CLIP-seq
MIRT886183	hsa-miR-519d	CLIP-seq
MIRT886184	hsa-miR-520d-5p	CLIP-seq
MIRT886185	hsa-miR-520g	CLIP-seq
MIRT886186	hsa-miR-520h	CLIP-seq
MIRT886187	hsa-miR-524-5p	CLIP-seq
MIRT886188	hsa-miR-532-3p	CLIP-seq
MIRT886189	hsa-miR-545	CLIP-seq
MIRT886190	hsa-miR-548a-3p	CLIP-seq
MIRT886191	hsa-miR-548ae	CLIP-seq
MIRT886192	hsa-miR-548aj	CLIP-seq
MIRT886193	hsa-miR-548am	CLIP-seq
MIRT886194	hsa-miR-548e	CLIP-seq
MIRT886195	hsa-miR-548f	CLIP-seq
MIRT886196	hsa-miR-548p	CLIP-seq
MIRT886197	hsa-miR-548x	CLIP-seq
MIRT886198	hsa-miR-582-3p	CLIP-seq
MIRT886199	hsa-miR-582-5p	CLIP-seq
MIRT886200	hsa-miR-93	CLIP-seq
MIRT886191	hsa-miR-548ae	CLIP-seq
MIRT886192	hsa-miR-548aj	CLIP-seq
MIRT886193	hsa-miR-548am	CLIP-seq
MIRT886197	hsa-miR-548x	CLIP-seq
MIRT1962818	hsa-miR-3920	CLIP-seq
MIRT1962819	hsa-miR-4427	CLIP-seq
MIRT886168	hsa-miR-4438	CLIP-seq
MIRT1962820	hsa-miR-4477a	CLIP-seq
MIRT886170	hsa-miR-4477b	CLIP-seq
MIRT886172	hsa-miR-4687-3p	CLIP-seq
MIRT1962821	hsa-miR-4719	CLIP-seq
MIRT886141	hsa-miR-106a	CLIP-seq
MIRT886142	hsa-miR-106b	CLIP-seq
MIRT2199184	hsa-miR-1228	CLIP-seq
MIRT886149	hsa-miR-17	CLIP-seq
MIRT886153	hsa-miR-20a	CLIP-seq
MIRT886154	hsa-miR-20b	CLIP-seq
MIRT886157	hsa-miR-3120-3p	CLIP-seq
MIRT2199185	hsa-miR-3143	CLIP-seq
MIRT2199186	hsa-miR-3661	CLIP-seq
MIRT1962818	hsa-miR-3920	CLIP-seq
MIRT886163	hsa-miR-3944-5p	CLIP-seq
MIRT886171	hsa-miR-4490	CLIP-seq
MIRT2199187	hsa-miR-4646-5p	CLIP-seq
MIRT2199188	hsa-miR-4747-5p	CLIP-seq
MIRT2199189	hsa-miR-4793-5p	CLIP-seq
MIRT886180	hsa-miR-519a	CLIP-seq
MIRT886181	hsa-miR-519b-3p	CLIP-seq
MIRT886182	hsa-miR-519c-3p	CLIP-seq
MIRT886183	hsa-miR-519d	CLIP-seq
MIRT886184	hsa-miR-520d-5p	CLIP-seq
MIRT886185	hsa-miR-520g	CLIP-seq
MIRT886186	hsa-miR-520h	CLIP-seq
MIRT886187	hsa-miR-524-5p	CLIP-seq
MIRT2199190	hsa-miR-543	CLIP-seq
MIRT886189	hsa-miR-545	CLIP-seq
MIRT886190	hsa-miR-548a-3p	CLIP-seq
MIRT886191	hsa-miR-548ae	CLIP-seq
MIRT886192	hsa-miR-548aj	CLIP-seq
MIRT886193	hsa-miR-548am	CLIP-seq
MIRT886194	hsa-miR-548e	CLIP-seq
MIRT886195	hsa-miR-548f	CLIP-seq
MIRT886197	hsa-miR-548x	CLIP-seq
MIRT886198	hsa-miR-582-3p	CLIP-seq
MIRT2199191	hsa-miR-627	CLIP-seq
MIRT2199192	hsa-miR-631	CLIP-seq
MIRT886200	hsa-miR-93	CLIP-seq
MIRT2385963	hsa-miR-4271	CLIP-seq
MIRT2385964	hsa-miR-4725-3p	CLIP-seq
MIRT2385965	hsa-miR-4795-5p	CLIP-seq
MIRT2446890	hsa-miR-3174	CLIP-seq
MIRT2446891	hsa-miR-4803	CLIP-seq
MIRT2446892	hsa-miR-496	CLIP-seq
MIRT2501932	hsa-miR-1208	CLIP-seq
MIRT2501933	hsa-miR-1226	CLIP-seq
MIRT886145	hsa-miR-1229	CLIP-seq
MIRT2501934	hsa-miR-1279	CLIP-seq
MIRT886146	hsa-miR-1305	CLIP-seq
MIRT2501935	hsa-miR-18a	CLIP-seq
MIRT2501936	hsa-miR-18b	CLIP-seq
MIRT2501937	hsa-miR-204	CLIP-seq
MIRT2501938	hsa-miR-211	CLIP-seq
MIRT2501939	hsa-miR-2681	CLIP-seq
MIRT2199185	hsa-miR-3143	CLIP-seq
MIRT2501940	hsa-miR-3163	CLIP-seq
MIRT2501941	hsa-miR-340	CLIP-seq
MIRT2501942	hsa-miR-3613-3p	CLIP-seq
MIRT2501943	hsa-miR-3647-3p	CLIP-seq
MIRT2501944	hsa-miR-3654	CLIP-seq
MIRT2199186	hsa-miR-3661	CLIP-seq
MIRT886160	hsa-miR-3672	CLIP-seq
MIRT2501945	hsa-miR-374a	CLIP-seq
MIRT2501946	hsa-miR-374b	CLIP-seq
MIRT1962818	hsa-miR-3920	CLIP-seq
MIRT2501947	hsa-miR-4282	CLIP-seq
MIRT2501948	hsa-miR-4284	CLIP-seq
MIRT2501949	hsa-miR-431	CLIP-seq
MIRT2501950	hsa-miR-4437	CLIP-seq
MIRT886168	hsa-miR-4438	CLIP-seq
MIRT2501951	hsa-miR-4474-5p	CLIP-seq
MIRT1962820	hsa-miR-4477a	CLIP-seq
MIRT886170	hsa-miR-4477b	CLIP-seq
MIRT2501952	hsa-miR-452	CLIP-seq
MIRT2501953	hsa-miR-4638-3p	CLIP-seq
MIRT2199187	hsa-miR-4646-5p	CLIP-seq
MIRT2501954	hsa-miR-4668-3p	CLIP-seq
MIRT2501955	hsa-miR-4674	CLIP-seq
MIRT2501956	hsa-miR-4676-3p	CLIP-seq
MIRT886172	hsa-miR-4687-3p	CLIP-seq
MIRT2501957	hsa-miR-4705	CLIP-seq
MIRT2501958	hsa-miR-4711-3p	CLIP-seq
MIRT1962821	hsa-miR-4719	CLIP-seq
MIRT2501959	hsa-miR-4733-3p	CLIP-seq
MIRT2501960	hsa-miR-4735-3p	CLIP-seq
MIRT2501961	hsa-miR-4735-5p	CLIP-seq
MIRT2199188	hsa-miR-4747-5p	CLIP-seq
MIRT2501962	hsa-miR-4755-5p	CLIP-seq
MIRT2501963	hsa-miR-4760-3p	CLIP-seq
MIRT2501964	hsa-miR-4775	CLIP-seq
MIRT2501965	hsa-miR-4780	CLIP-seq
MIRT2501966	hsa-miR-4786-5p	CLIP-seq
MIRT2501967	hsa-miR-4789-3p	CLIP-seq
MIRT2501968	hsa-miR-4796-5p	CLIP-seq
MIRT886179	hsa-miR-498	CLIP-seq
MIRT2501969	hsa-miR-500a	CLIP-seq
MIRT2501970	hsa-miR-501-5p	CLIP-seq
MIRT2501971	hsa-miR-513a-3p	CLIP-seq
MIRT886190	hsa-miR-548a-3p	CLIP-seq
MIRT2501972	hsa-miR-548c-3p	CLIP-seq
MIRT886194	hsa-miR-548e	CLIP-seq
MIRT886195	hsa-miR-548f	CLIP-seq
MIRT2501973	hsa-miR-581	CLIP-seq
MIRT2501974	hsa-miR-590-3p	CLIP-seq
MIRT2501975	hsa-miR-592	CLIP-seq
MIRT2501976	hsa-miR-599	CLIP-seq
MIRT2501977	hsa-miR-607	CLIP-seq
MIRT2501978	hsa-miR-623	CLIP-seq
MIRT2199192	hsa-miR-631	CLIP-seq
MIRT2501979	hsa-miR-642b	CLIP-seq
MIRT2501980	hsa-miR-769-5p	CLIP-seq
MIRT2501981	hsa-miR-944	CLIP-seq
MIRT2501932	hsa-miR-1208	CLIP-seq
MIRT2501933	hsa-miR-1226	CLIP-seq
MIRT886145	hsa-miR-1229	CLIP-seq
MIRT2501934	hsa-miR-1279	CLIP-seq
MIRT886146	hsa-miR-1305	CLIP-seq
MIRT2501937	hsa-miR-204	CLIP-seq
MIRT2501938	hsa-miR-211	CLIP-seq
MIRT2501939	hsa-miR-2681	CLIP-seq
MIRT2501942	hsa-miR-3613-3p	CLIP-seq
MIRT886160	hsa-miR-3672	CLIP-seq
MIRT2501945	hsa-miR-374a	CLIP-seq
MIRT2501946	hsa-miR-374b	CLIP-seq
MIRT2501948	hsa-miR-4284	CLIP-seq
MIRT2501950	hsa-miR-4437	CLIP-seq
MIRT2501951	hsa-miR-4474-5p	CLIP-seq
MIRT1962820	hsa-miR-4477a	CLIP-seq
MIRT2501952	hsa-miR-452	CLIP-seq
MIRT2501954	hsa-miR-4668-3p	CLIP-seq
MIRT2501955	hsa-miR-4674	CLIP-seq
MIRT2501956	hsa-miR-4676-3p	CLIP-seq
MIRT2501957	hsa-miR-4705	CLIP-seq
MIRT2501958	hsa-miR-4711-3p	CLIP-seq
MIRT2501959	hsa-miR-4733-3p	CLIP-seq
MIRT2501962	hsa-miR-4755-5p	CLIP-seq
MIRT2501963	hsa-miR-4760-3p	CLIP-seq
MIRT2501964	hsa-miR-4775	CLIP-seq
MIRT2501965	hsa-miR-4780	CLIP-seq
MIRT2501967	hsa-miR-4789-3p	CLIP-seq
MIRT2501968	hsa-miR-4796-5p	CLIP-seq
MIRT886179	hsa-miR-498	CLIP-seq
MIRT2501969	hsa-miR-500a	CLIP-seq
MIRT2501970	hsa-miR-501-5p	CLIP-seq
MIRT2501972	hsa-miR-548c-3p	CLIP-seq
MIRT2501973	hsa-miR-581	CLIP-seq
MIRT2501974	hsa-miR-590-3p	CLIP-seq
MIRT2501975	hsa-miR-592	CLIP-seq
MIRT2501976	hsa-miR-599	CLIP-seq
MIRT2501977	hsa-miR-607	CLIP-seq
MIRT2501978	hsa-miR-623	CLIP-seq
MIRT2501979	hsa-miR-642b	CLIP-seq
MIRT2501981	hsa-miR-944	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0005515	Function	Protein binding	IPI	15607035, 20195357, 21516116, 25416956, 31515488, 32814053
GO:0005634	Component	Nucleus	ISS	12954732
GO:0005794	Component	Golgi apparatus	IDA	10942595
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	14654843, 21399614
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IDA	12717444
GO:0007286	Process	Spermatid development	ISS	12954732
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	12717444
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0017134	Function	Fibroblast growth factor binding	IPI	12717444
GO:0034453	Process	Microtubule anchoring	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12717444
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0051260	Process	Protein homooligomerization	IEA
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS

MIM	HGNC	e!Ensembl
607951	30794	ENSG00000166037

Protein

UniProt ID

Q86XR8

Protein name

Centrosomal protein of 57 kDa (Cep57) (FGF2-interacting protein) (Testis-specific protein 57) (Translokin)

Protein function

Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but t

PDB

4L0R , 8IBH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14073	Cep57_CLD	68 → 245	Centrosome localisation domain of Cep57	Coiled-coil
PF06657	Cep57_MT_bd	348 → 421	Centrosome microtubule-binding domain of Cep57	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12717444}.

Sequence

MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLA
YPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKN
EESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQT
HVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLET
NRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEEL
SEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQL
LKDMQSIQNSLQSSSLCWDY

Sequence length

500

Interactions

View interactions

	Reactome
			Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane AURKA Activation by TPX2

Show/Hide Causal Diseases (19)

Disease term	Disease name	dbSNP ID	References
Causal
Atrial septal defect	Atrial Septal Defects	rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074 View all (25 more)
Cafe-au-lait spot	Cafe au lait spots, multiple	rs1057518792, rs1555613206, rs1555608663
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Glaucoma	Glaucoma	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328 View all (29 more)
Holoprosencephaly	Holoprosencephaly	rs121917878, rs121917879, rs121917880, rs1572624159, rs137853021, rs397515364, rs397515365, rs2147483647, rs121909067, rs121909070, rs199476093, rs28936675, rs104894044, rs104894045, rs104894040 View all (76 more)
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)
Lymphoblastic leukemia	Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Microphthalmos	Microphthalmos	rs794726862, rs1329285216
Mosaic variegated aneuploidy	Mosaic variegated aneuploidy syndrome 1, MOSAIC VARIEGATED ANEUPLOIDY SYNDROME 2, Mosaic variegated aneuploidy syndrome	rs28989186, rs1392909108, rs1565326373, rs1166323407, rs387906977, rs750364303, rs376882637, rs1131692330, rs1555052278, rs769350713, rs767213728, rs759242053, rs1565334264, rs1566824608, rs1401171363 View all (9 more)	28553959, 21552266, 24259107, 26743940, 30035751, 14654843, 30010053, 30147898, 22508265, 17803911, 12116237, 23569207
Muscular dystrophy	Muscular Dystrophy	rs200198778, rs121908110, rs121908185, rs58932704, rs61672878, rs60458016, rs387906881, rs397509417, rs267607644, rs267607634, rs59332535, rs797045898, rs755660222, rs142908436, rs886039913 View all (15 more)
Myelodysplasia	Myelodysplasia	rs141601766, rs1261178797
Myelodysplastic syndrome	MYELODYSPLASTIC SYNDROME	rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Nephroblastoma	Nephroblastoma	rs1553551874, rs1555913934, rs769116796
Rhabdomyosarcoma	Rhabdomyosarcoma	rs137854557, rs121909224, rs63751466, rs11540652, rs28934874, rs104894229, rs104894230, rs267606708, rs80357867, rs276174889, rs80359011, rs80358556, rs80359391, rs80357989, rs886037650 View all (19 more)
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Ambiguous genitalia	Ambiguous Genitalia	ClinVar
Mosaic Variegated Aneuploidy	mosaic variegated aneuploidy syndrome	GenCC

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Aneuploidy	Associate	21552266
Arthritis Rheumatoid	Associate	32831971
Brachydactyly	Associate	35434947
Carcinoma	Associate	28553959
Genetic Diseases Inborn	Associate	29659569
Growth Disorders	Associate	35434947
Microcephalic Osteodysplastic Primordial Dwarfism Type II	Associate	30804344
Microcephaly	Associate	35434947
Mosaic variegated aneuploidy syndrome	Associate	21552266, 30804344, 31943948, 35434947
Neoplasms	Associate	29659569
Prostate cancer familial	Associate	29659569
Prostatic Neoplasms	Associate	29659569
Short Rib Polydactyly Syndrome	Associate	31943948

CEP57 (centrosomal protein 57)