CD69 (CD69 molecule)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
969
Gene name Gene Name - the full gene name approved by the HGNC.
CD69 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD69
Synonyms (NCBI Gene) Gene synonyms aliases
AIM, BL-AC/P26, CLEC2C, EA1, GP32/28, MLR-3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
EA1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may ac
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT016695 hsa-miR-335-5p Microarray 18185580
MIRT728022 hsa-miR-92a-3p HITS-CLIP 22473208
MIRT728021 hsa-miR-92b-3p HITS-CLIP 22473208
MIRT728020 hsa-miR-32-5p HITS-CLIP 22473208
MIRT728022 hsa-miR-92a-3p Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot 26937033
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
NFKB1 Unknown 10480634
RELA Unknown 10480634
SLA2 Unknown 11696592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 8340758
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 16525420, 25416956, 32296183
GO:0005887 Component Integral component of plasma membrane TAS 8340758
GO:0009897 Component External side of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
107273 1694 ENSG00000110848
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q07108
Protein name Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)
Protein function Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as a
PDB 1E87 , 1E8I , 1FM5 , 3CCK , 3HUP , 8G94
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 102 → 196 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Sequence 
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
VSSMECEKNLYWICNKPYK
Sequence length 199
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 12882836
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 19430480, 25751624
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)		 24076602, 22190364
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Hypothyroidism Hypothyroidism GWAS
Show/Hide Text Mining Associations (208)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Inhibit 28112260
Acute Coronary Syndrome Stimulate 20430391
Adenocarcinoma Stimulate 17082613
Adenocarcinoma Associate 35986757
Adenocarcinoma of Lung Associate 17082613, 29453833, 37880277
Airway Obstruction Associate 16246539
Alopecia Areata Associate 16374469
Alzheimer Disease Stimulate 37949669
Anemia Sickle Cell Associate 32411797
Angioedema Associate 8813097