CD69 (CD69 molecule)

Gene

• Entrez ID: 969
• Gene name: CD69 molecule
• Gene symbol: CD69
• Synonyms (NCBI Gene): AIM, BL-AC/P26, CLEC2C, EA1, GP32/28, MLR-3
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may ac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016695	hsa-miR-335-5p	Microarray	18185580
MIRT728022	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT728021	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT728020	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT728022	hsa-miR-92a-3p	Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26937033
MIRT728022	hsa-miR-92a-3p	Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26937033
MIRT2436190	hsa-miR-369-3p	CLIP-seq
MIRT2436191	hsa-miR-374a	CLIP-seq
MIRT2436192	hsa-miR-374b	CLIP-seq
MIRT2436193	hsa-miR-502-5p	CLIP-seq
MIRT2436194	hsa-miR-642b	CLIP-seq
MIRT2499889	hsa-miR-4699-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	10480634
RELA	Unknown	10480634
SLA2	Unknown	11696592

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IDA	22344443
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	24752896
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	8340758
GO:0005515	Function	Protein binding	IPI	16525420, 25416956, 32296183
GO:0005886	Component	Plasma membrane	IDA	37039481
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8340758
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	11101293
GO:0042802	Function	Identical protein binding	IDA	11101293
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0072678	Process	T cell migration	IDA	20829352, 37039481
GO:0140313	Function	Molecular sequestering activity	IDA	37039481
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	20696842
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	24752896
GO:2000405	Process	Negative regulation of T cell migration	IDA	37039481

Other IDs

• MIM: 107273
• HGNC: 1694
• e!Ensembl: ENSG00000110848

Protein

• UniProt ID: Q07108
• Protein name: Early activation antigen CD69 (Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)
• Protein function: Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as a
• PDB: 1E87, 1E8I, 1FM5, 3CCK, 3HUP, 8G94
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	102 → 196	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
• Sequence:

  MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
  LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
  AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
  VSSMECEKNLYWICNKPYK

• Sequence length: 199