Gene Gene information from NCBI Gene database.
Entrez ID 968
Gene name CD68 molecule
Gene symbol CD68
Synonyms (NCBI Gene)
GP110LAMP4SCARD1
Chromosome 17
Chromosome location 17p13.1
Summary This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosome
miRNA miRNA information provided by mirtarbase database.
217
miRTarBase ID miRNA Experiments Reference
MIRT020775 hsa-miR-155-5p Western blot 21030878
MIRT650254 hsa-miR-4282 HITS-CLIP 23824327
MIRT650253 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT650252 hsa-miR-3163 HITS-CLIP 23824327
MIRT650251 hsa-miR-1470 HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
ELF1 Activation 12676954
ESR2 Unknown 11517296
IRF4 Repression 12676954
IRF8 Repression 12676954
SPI1 Repression 12676954
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0002437 Process Inflammatory response to antigenic stimulus ISS
GO:0002605 Process Negative regulation of dendritic cell antigen processing and presentation ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005764 Component Lysosome IEA
GO:0005764 Component Lysosome ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
153634 1693 ENSG00000129226
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P34810
Protein name Macrosialin (Gp110) (CD antigen CD68)
Protein function Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01299 Lamp 155 303 Lysosome-associated membrane glycoprotein (Lamp) Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, fac
Sequence
MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT
THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT
VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV
MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY
MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA
QLP
HTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Lysosome   Neutrophil degranulation