Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	968
Gene name Gene Name - the full gene name approved by the HGNC.	CD68 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD68
Synonyms (NCBI Gene) Gene synonyms aliases	GP110, LAMP4, SCARD1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosome

Show/Hide all(217)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020775	hsa-miR-155-5p	Western blot	21030878
MIRT650254	hsa-miR-4282	HITS-CLIP	23824327
MIRT650253	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT650252	hsa-miR-3163	HITS-CLIP	23824327
MIRT650251	hsa-miR-1470	HITS-CLIP	23824327
MIRT650250	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT650249	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650248	hsa-miR-4469	HITS-CLIP	23824327
MIRT650247	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT650246	hsa-miR-4287	HITS-CLIP	23824327
MIRT650245	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT650244	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650243	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT650241	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT650242	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650240	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT650239	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650238	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650254	hsa-miR-4282	HITS-CLIP	23824327
MIRT650253	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT650252	hsa-miR-3163	HITS-CLIP	23824327
MIRT650251	hsa-miR-1470	HITS-CLIP	23824327
MIRT650250	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT650249	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT650248	hsa-miR-4469	HITS-CLIP	23824327
MIRT650247	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT650246	hsa-miR-4287	HITS-CLIP	23824327
MIRT650245	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT650244	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650243	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT650241	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT650242	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650240	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT650239	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650238	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT2499881	hsa-miR-1228	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT2499882	hsa-miR-197	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT2499883	hsa-miR-3160-5p	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT2499884	hsa-miR-375	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2499885	hsa-miR-411	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2499886	hsa-miR-4537	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT2499887	hsa-miR-4794	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2499888	hsa-miR-5096	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq
MIRT2385755	hsa-miR-106a	CLIP-seq
MIRT2385756	hsa-miR-106b	CLIP-seq
MIRT876133	hsa-miR-1207-3p	CLIP-seq
MIRT2499881	hsa-miR-1228	CLIP-seq
MIRT876125	hsa-miR-1245	CLIP-seq
MIRT2196679	hsa-miR-1343	CLIP-seq
MIRT1959672	hsa-miR-150	CLIP-seq
MIRT2385757	hsa-miR-17	CLIP-seq
MIRT876126	hsa-miR-1825	CLIP-seq
MIRT2499882	hsa-miR-197	CLIP-seq
MIRT876134	hsa-miR-1972	CLIP-seq
MIRT876127	hsa-miR-199a-5p	CLIP-seq
MIRT876128	hsa-miR-199b-5p	CLIP-seq
MIRT2385758	hsa-miR-20a	CLIP-seq
MIRT2385759	hsa-miR-20b	CLIP-seq
MIRT2385760	hsa-miR-302a	CLIP-seq
MIRT2385761	hsa-miR-302b	CLIP-seq
MIRT2385762	hsa-miR-302c	CLIP-seq
MIRT2385763	hsa-miR-302d	CLIP-seq
MIRT2385764	hsa-miR-302e	CLIP-seq
MIRT1959673	hsa-miR-3187-3p	CLIP-seq
MIRT1959674	hsa-miR-3663-5p	CLIP-seq
MIRT876129	hsa-miR-371-5p	CLIP-seq
MIRT876130	hsa-miR-371b-5p	CLIP-seq
MIRT2385765	hsa-miR-372	CLIP-seq
MIRT2385766	hsa-miR-373	CLIP-seq
MIRT876131	hsa-miR-3925-3p	CLIP-seq
MIRT2196680	hsa-miR-4277	CLIP-seq
MIRT1959675	hsa-miR-4435	CLIP-seq
MIRT876135	hsa-miR-4438	CLIP-seq
MIRT2499886	hsa-miR-4537	CLIP-seq
MIRT1959676	hsa-miR-4701-5p	CLIP-seq
MIRT1959677	hsa-miR-4716-5p	CLIP-seq
MIRT1959678	hsa-miR-4727-5p	CLIP-seq
MIRT2385767	hsa-miR-4731-5p	CLIP-seq
MIRT1959679	hsa-miR-4755-3p	CLIP-seq
MIRT1959680	hsa-miR-4781-3p	CLIP-seq
MIRT2196681	hsa-miR-498	CLIP-seq
MIRT876136	hsa-miR-5095	CLIP-seq
MIRT2499888	hsa-miR-5096	CLIP-seq
MIRT2385768	hsa-miR-512-3p	CLIP-seq
MIRT2385769	hsa-miR-519d	CLIP-seq
MIRT2385770	hsa-miR-520a-3p	CLIP-seq
MIRT2385771	hsa-miR-520b	CLIP-seq
MIRT2385772	hsa-miR-520c-3p	CLIP-seq
MIRT2385773	hsa-miR-520d-3p	CLIP-seq
MIRT2385774	hsa-miR-520e	CLIP-seq
MIRT2385775	hsa-miR-520g	CLIP-seq
MIRT2385776	hsa-miR-520h	CLIP-seq
MIRT1959681	hsa-miR-548s	CLIP-seq
MIRT876137	hsa-miR-562	CLIP-seq
MIRT1959682	hsa-miR-588	CLIP-seq
MIRT876132	hsa-miR-640	CLIP-seq
MIRT2385777	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
ELF1	Activation	12676954
ESR2	Unknown	11517296
IRF4	Repression	12676954
IRF8	Repression	12676954
SPI1	Repression	12676954

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002437	Process	Inflammatory response to antigenic stimulus	ISS
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005764	Component	Lysosome	ISS
GO:0005765	Component	Lysosomal membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	28601280
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007568	Process	Aging	ISS
GO:0016020	Component	Membrane	TAS	7680921
GO:0016021	Component	Integral component of membrane	IEA
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0031902	Component	Late endosome membrane	IBA	21873635
GO:0035425	Process	Autocrine signaling	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0072594	Process	Establishment of protein localization to organelle	IBA	21873635
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS

MIM	HGNC	e!Ensembl
153634	1693	ENSG00000129226

Protein

UniProt ID

P34810

Protein name

Macrosialin (Gp110) (CD antigen CD68)

Protein function

Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01299	Lamp	155 → 303	Lysosome-associated membrane glycoprotein (Lamp)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, fac

Sequence

MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT
THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT
VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV
MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY
MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA
QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL

Sequence length

354

Interactions

View interactions

	KEGG		Reactome
	Lysosome		Neutrophil degranulation

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Familial	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	11796754
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	28789951
Hyperinsulinism	Hyperinsulinism	rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209 View all (23 more)	29035695
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	11796754
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	29035695

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome			GWAS

Show/Hide Text Mining Associations (308)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	30942389
Abscess	Associate	10435362
Acute Disease	Associate	32651678
Adenocarcinoma Follicular	Associate	26875556
Adenocarcinoma Mucinous	Associate	34497449
Adenocarcinoma of Lung	Associate	29722145, 37280312, 37880277
Adenoma	Associate	29543850
Adenomyosis	Associate	29264987
Adrenal Hyperplasia Congenital	Associate	34616364
Adrenal Rest Tumor	Associate	34616364
Alexander Disease	Associate	25516918
Alzheimer Disease	Associate	30193587, 39930501
Amyotrophic Lateral Sclerosis	Associate	22720079
Amyotrophic lateral sclerosis 1	Associate	30215603
Anemia Aplastic	Associate	36469034
Angiomyolipoma	Associate	29052596
Anophthalmia with pulmonary hypoplasia	Associate	33237432
Anthracosis	Associate	23717691
Aortic Aneurysm Abdominal	Associate	24997808, 25993291
Aortic Dissection	Associate	34202072
Aortic Stenosis Supravalvular	Associate	32960096
Arthritis Psoriatic	Associate	21272347, 23006144, 35055107
Arthritis Rheumatoid	Associate	10857783, 14730603, 16207318, 17040961, 17613556, 23055831, 24314260, 27424032, 31320744
Astrocytoma	Associate	19661345
Atherosclerosis	Associate	12238639, 22395501, 24036496, 27207962, 35202001
Atherosclerosis	Inhibit	29420090
Autism Spectrum Disorder	Associate	32129578
Azoospermia Nonobstructive	Stimulate	24895614
Biliary Atresia	Associate	15128911
Bipolar Disorder	Associate	25487697
Blast Injuries	Stimulate	36508265
Brain Neoplasms	Associate	32974852, 40510346
Breast Diseases	Associate	36380012
Breast Neoplasms	Associate	23300781, 26391151, 26979828, 27117582, 28029650, 28639912, 30558648, 32580398, 32799413, 32810665, 36598153, 36638208, 36946266
Bronchiolitis Obliterans Syndrome	Associate	21386923
Cancer Pain	Associate	30610800
Carbamoyl Phosphate Synthase I Deficiency Disease	Associate	38032149
Carcinogenesis	Associate	38219446
Carcinoma	Associate	24051699, 37194064
Carcinoma	Stimulate	32313727
Carcinoma Basal Cell	Associate	21980389, 22664550
Carcinoma Ductal	Associate	26391151
Carcinoma Endometrioid	Associate	27465886
Carcinoma Giant Cell	Associate	21196886
Carcinoma Giant Cell	Stimulate	31655833
Carcinoma Hepatocellular	Associate	23555776, 28656201, 32165607, 33860125, 34092607, 34157683, 35202002, 35550532, 37370037, 39756577, 39838375
Carcinoma Non Small Cell Lung	Associate	29745083, 30956278, 31615933, 35793873, 35928634
Carcinoma Pancreatic Ductal	Associate	24797069, 27637082, 37649613, 40410886
Carcinoma Renal Cell	Associate	32313718, 35120484, 35550532, 35982911
Carcinoma Signet Ring Cell	Associate	35042311
Carcinoma Squamous Cell	Associate	18525219, 35550532
Carcinoma Squamous Cell	Stimulate	35928634
Cardiomyopathies	Associate	33988313
Cardiovascular Diseases	Associate	32245320
Carotid Stenosis	Associate	19112034
Cheilitis	Stimulate	38219446
Cherubism	Associate	30236129
Cholangiocarcinoma	Associate	33228682, 35317832, 36433731, 39359389
Cholangitis Sclerosing	Associate	29180269
Cholecystitis	Associate	24375043
Chordoma	Associate	40514756
Choriocarcinoma	Associate	36875956
Chronic Disease	Associate	37300938
Chronic Traumatic Encephalopathy	Associate	30390709
Cognition Disorders	Associate	27256292
Colonic Neoplasms	Stimulate	30243096
Colorectal Neoplasms	Associate	23963148, 29543850, 30918427, 33818637, 34671130, 34964155, 36114487, 36611136
Conjunctival Diseases	Stimulate	34697202
Connective Tissue Diseases	Associate	32886246
Corneal Perforation	Associate	21386923
Coronary Aneurysm	Associate	39234691
Coronary Artery Disease	Associate	23007990, 27727089, 32245320
COVID 19	Stimulate	33947851, 34436630, 36430210
COVID 19	Associate	34225749, 37109672, 37839656, 39337571
COVID 19	Inhibit	35064006
Craniopharyngioma	Associate	40721446
Death	Inhibit	39201801
Dementia	Associate	27256292
Dental Plaque	Stimulate	19112034, 25170063
Dental Plaque	Associate	23273713, 25046588
Depressive Disorder Major	Associate	32917850, 34706460
Dermatitis Allergic Contact	Associate	18798012
Dermatomyositis	Associate	24286299, 35762881
Diabetes Gestational	Stimulate	35390031, 38084523
Diabetes Mellitus	Associate	21764240, 25899460, 38084523
Diabetes Mellitus	Stimulate	26873505, 28454543, 30894181
Diabetes Mellitus Type 1	Stimulate	36657987
Diabetic Nephropathies	Associate	24786705
Diastrophic dysplasia	Associate	27496082
Diffuse Neurofibrillary Tangles with Calcification	Associate	35164877
Disease	Inhibit	39201801
Dyslipidemias	Associate	35274685
Dyspepsia	Inhibit	36264979
Ectodermal Dysplasia	Stimulate	24375043
Ectrodactyly	Stimulate	35687294
Endometrial Neoplasms	Stimulate	29264987
Endometriosis	Stimulate	17548071
Endometriosis	Associate	30845295, 35628423
Endometritis	Stimulate	31718829
Erdheim Chester Disease	Associate	20558949, 30305475, 33602153
Esophageal Neoplasms	Associate	22134872
Fatty Liver Alcoholic	Inhibit	31337151
Fetal Growth Retardation	Stimulate	32973787
Fetal Growth Retardation	Associate	33813474
Fibrolamellar hepatocellular carcinoma	Associate	21113139, 26712049, 28862261
Fuchs' Endothelial Dystrophy	Associate	21751146
Gallstones	Associate	24375043
Gastrointestinal Stromal Tumors	Associate	25120735
Giant Cell Arteritis	Associate	35003111
Giant Cell Tumors	Associate	15607894, 26275199
Glioblastoma	Associate	30299157, 35550532
Glioma	Associate	19661345, 28789475, 33371165, 34645618, 35316217, 35550532
Glomerulonephritis	Associate	25026899
Glomerulonephritis IGA	Stimulate	33389462
Glomerulonephritis Membranoproliferative	Associate	11471306
Glutaric Acidemia I	Associate	15866583
Granular Cell Tumor	Associate	15214825, 28057062, 37474473
Granuloma	Associate	27341317, 32566036, 39373788
Granuloma Annulare	Associate	11972709
Granuloma Giant Cell	Associate	21196886, 26275199, 28832079, 31655833
Graves Disease	Associate	8025214
Graves Ophthalmopathy	Associate	32176314
HAIR AN syndrome	Stimulate	18825363
Hashimoto Disease	Associate	29924048
Head and Neck Neoplasms	Associate	39619326
Heart Diseases	Associate	38379280, 39337571
Hemangioendothelioma	Associate	38206210
Hematologic Neoplasms	Associate	12483012
Hepatitis Autoimmune	Associate	27183637
Hepatitis B	Associate	26919045
Hepatitis B Chronic	Stimulate	29921328
Hepatitis C	Stimulate	31260499
Hereditary Autoinflammatory Diseases	Associate	33284430
Hereditary Diffuse Leukoencephalopathy with Spheroids	Stimulate	32430064
Histiocytoma Angiomatoid Fibrous	Associate	26261484
Histiocytosis	Associate	24369227, 33950285
Histiocytosis Langerhans Cell	Associate	27760550
Histiocytosis Non Langerhans Cell	Associate	24656263
Histiocytosis Sinus	Associate	32776915, 37301673
HIV Infections	Inhibit	15868898
HIV Infections	Stimulate	24405578
Hodgkin Disease	Associate	21071500, 21602260, 22289504, 22948049, 23045593, 25978381, 31714922, 32019558, 33558066
Hypokalemia	Associate	30396309
Hypoxia	Associate	18371555
Hypoxia	Inhibit	36093941
Idiopathic Pulmonary Fibrosis	Associate	22037258, 32213567
IgA Vasculitis	Associate	20529817
Immunoglobulin G4 Related Disease	Associate	28205524
Infarction Middle Cerebral Artery	Associate	37270727
Infections	Inhibit	24341794
Infertility	Associate	12137866
Inflammation	Associate	11090473, 15618585, 17090638, 18057090, 18262644, 18825363, 18829234, 19153557, 20150436, 20930711, 22253938, 23573303, 25385008, 25888309, 26091509 View all (17 more)
Inflammation	Stimulate	23785453, 34725292
Inflammatory Bowel Diseases	Associate	23573303, 24301659
Inflammatory Breast Neoplasms	Associate	35705026
Insulin Resistance	Stimulate	18270300
Insulin Resistance	Associate	21197447, 26871994
Intracranial Arteriovenous Malformations	Associate	20881566
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	12379712
Joint Diseases	Associate	21163925
Kidney Diseases	Associate	31535918, 34459751, 38255818
Leishmaniasis	Associate	23440109
Leukemia Hairy Cell	Associate	24903677
Leukemia Lymphocytic Chronic B Cell	Associate	24464016
Leukemia Lymphocytic Chronic B Cell	Inhibit	27462782
Leukemia Lymphoma Adult T Cell	Associate	23557330
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	27999815
Leukemia Myeloid Accelerated Phase	Stimulate	27999815
Leukemia Myeloid Acute	Associate	29720577
Leukemia Myeloid Chronic Phase	Stimulate	27999815
Leukemic Infiltration	Associate	29284429
Leukoencephalopathies	Associate	30682074, 33336479
Lewy Body Disease	Associate	40532443
Lichen Planus	Associate	18055547
Lip Neoplasms	Associate	38219446
Lipodystrophy	Associate	18430964
Lung Diseases	Associate	33589523
Lung Diseases Interstitial	Associate	16287509
Lung Neoplasms	Associate	29745083, 32245320
Lupus Erythematosus Systemic	Associate	35762881, 39290707
Lymphatic Metastasis	Associate	26391151, 29434448, 29745083, 36372883, 36433731
Lymphoma Extranodal NK T Cell	Associate	31653980
Lymphoma Follicular	Associate	31273513, 35816682
Lymphoma Large B Cell Diffuse	Associate	25381134, 30430204, 31694577, 37205092, 40112808
Lymphoma Non Hodgkin	Associate	23795960
Lymphoma T Cell	Associate	25337185
Macrophage Activation Syndrome	Associate	22002519, 23988031, 24997808, 28524645, 37686069
Melanoma	Associate	24051699, 29054599, 30459241, 37562584
Melanoma	Inhibit	33009490
Meningeal Carcinomatosis	Inhibit	40510346
Meningioma	Associate	28191624
Metabolic Syndrome	Stimulate	23007990
Microsatellite Instability	Associate	26068398
Mitochondrial Diseases	Associate	23951013
Mouth Diseases	Associate	38255860
Moyamoya Disease	Associate	39290707
Multiple Myeloma	Associate	10029574
Multiple Myeloma	Inhibit	37170758
Multiple Sclerosis	Associate	31857644, 37715818
Muscle Neoplasms	Associate	24286299
Mycosis Fungoides	Stimulate	32556361
Myelodysplastic Syndromes	Associate	37366304
Myocardial Ischemia	Associate	30894181
Myopathies Nemaline	Associate	34043258
Myopathies Structural Congenital	Associate	24883329, 24885636, 30558648, 32883314, 34184083, 38358183, 38407700, 39531417
Myositis	Associate	21904631
Nasal Polyps	Associate	11182013, 23541322, 25361058
Nasopharyngeal Carcinoma	Associate	22745579
Necrosis	Associate	25516918, 30423808
Neoplasm Invasiveness	Associate	34092607, 35681497
Neoplasm Metastasis	Associate	23717691, 32974852, 36195882
Neoplasm Metastasis	Inhibit	37148007
Neoplasms	Associate	10656748, 12483012, 15832009, 16101177, 17076538, 18273514, 18283317, 19661345, 20822523, 21071500, 21602260, 21980389, 22289504, 22531528, 22555941 View all (100 more)
Neoplasms	Stimulate	30183516, 36757936
Neoplasms	Inhibit	31406165
Neoplasms Adipose Tissue	Associate	21197447
Neoplasms Adipose Tissue	Stimulate	25388403
Nephrogenic Fibrosing Dermopathy	Associate	18629675
Nephrosclerosis	Stimulate	22129502
Nephrotic Syndrome	Associate	35173708
Neuroinflammatory Diseases	Associate	30390709, 37270727
Non Muscle Invasive Bladder Neoplasms	Associate	36043478
Obesity	Stimulate	18262644, 19249917, 31320744, 34725292
Obesity	Associate	22836687, 28454543
Obesity	Inhibit	29035695
Odontogenic Cyst Calcifying	Associate	23206207
Opioid Related Disorders	Inhibit	22797933
Osteoarthritis	Associate	17613556, 27424032
Osteolysis	Associate	27196532
Ovarian Neoplasms	Associate	26541760, 30803719, 32249277, 35186171
Overbite	Associate	30682074
Overweight	Associate	31320744
Pancreatic Neoplasms	Associate	25557640, 32051287
Pancreatitis Chronic	Associate	32053120, 36264979
Pelvic Pain	Stimulate	29264987
Peri Implantitis	Associate	11395370, 35344630
Periapical Diseases	Associate	40217194
Periapical Granuloma	Associate	30631444, 40217194
Periapical Periodontitis	Associate	18926740
Periodontitis	Associate	35888586
Perivascular Epithelioid Cell Neoplasms	Associate	29052596
Pituitary ACTH Hypersecretion	Associate	30722035
Pityriasis Rosea	Associate	18798012
Placental Insufficiency	Associate	33813474
Plaque Atherosclerotic	Associate	18451330, 21350215, 22395501
Pneumonia	Associate	37109672
Polyposis Syndrome Hereditary Mixed 1	Associate	29543850
Pre Eclampsia	Inhibit	23480364
Pre Eclampsia	Stimulate	34725292
Precancerous Conditions	Associate	40416971
Premature Birth	Associate	33813474
Progressive Transformation of Germinal Centers	Associate	28205524
Prostatitis	Associate	37148007
Prosthesis Failure	Stimulate	28213791
Psoriasis	Associate	16645593, 20555352, 29182760
Pulmonary Disease Chronic Obstructive	Associate	32245320, 32915645
Radicular Cyst	Associate	40217194
Renal Insufficiency	Stimulate	22129502
Renal Insufficiency Chronic	Inhibit	30280599
Renal Insufficiency Chronic	Stimulate	34833374
Respiratory Distress Syndrome	Associate	19635508
Respiratory Tract Infections	Inhibit	30193587
Retinal Dysplasia	Associate	29543850, 37686454
Retinal Dysplasia	Stimulate	32416752
Retinoschisis	Associate	33601057
Rheumatic Diseases	Associate	15956138
Rhinitis	Associate	10543283
Sarcoma	Associate	32313727
Sarcoma Alveolar Soft Part	Associate	35628499
Sarcoma Myeloid	Associate	28574302
Schizophrenia	Associate	25487697, 30630651
Scleroderma Systemic	Associate	34504485
Seminoma	Associate	33104706
Sertoli Cell Only Syndrome	Stimulate	15866583
Severe Acute Respiratory Syndrome	Associate	19635508
Sjogren's Syndrome	Associate	25902739
Sjogren's Syndrome	Stimulate	27207443
Skin Diseases	Associate	34669971
Skull Base Neoplasms	Associate	40514756
Sleep Apnea Obstructive	Associate	32020899
Small Cell Lung Carcinoma	Associate	36705391
Soft Tissue Injuries	Associate	22018099
Squamous Cell Carcinoma of Head and Neck	Associate	17378915, 24883329, 28052009, 28122336, 29284429, 31744214, 32035062, 33307825
Squamous Intraepithelial Lesions	Stimulate	34919260
Still's Disease Adult Onset	Associate	26540556, 27317930
Stomach Neoplasms	Associate	28791370, 33457080, 37432407, 38358183
Stomach Neoplasms	Stimulate	29434448
Synovitis	Stimulate	27044395
Synovitis	Associate	31320744
Tachycardia Atrioventricular Nodal Reentry	Inhibit	37148007
Tendinopathy	Associate	29385715
Tertiary Lymphoid Structures	Associate	26540556
Thrombosis	Associate	36064651
Thymoma	Associate	35550532
Thymus Neoplasms	Associate	38071307
Thyroid Cancer Papillary	Associate	22870901
Thyroid Carcinoma Anaplastic	Associate	34184083
Thyroid Neoplasms	Associate	35550532
Tonsillitis	Associate	12116363
Tooth Erosion	Associate	15647425
Tracheal Stenosis	Associate	37647429
Triple Negative Breast Neoplasms	Associate	26752006, 29921315, 34732817
Urinary Bladder Neoplasms	Associate	26197470
Uterine Cervical Dysplasia	Associate	34919260
Uterine Cervical Neoplasms	Associate	33087896, 37109686, 39201801
Uveal melanoma	Associate	15113392, 19369244, 33203661
Weight Loss	Associate	23951013
Williams Syndrome	Stimulate	32960096

CD68 (CD68 molecule)