Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9674
Gene name Gene Name - the full gene name approved by the HGNC.
KIAA0040
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIAA0040
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q25.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT702501 hsa-miR-6776-3p HITS-CLIP 23313552
MIRT702500 hsa-miR-140-3p HITS-CLIP 23313552
MIRT702499 hsa-miR-101-5p HITS-CLIP 23313552
MIRT702498 hsa-miR-4709-5p HITS-CLIP 23313552
MIRT702497 hsa-miR-489-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616696 28950 ENSG00000235750
Protein
UniProt ID Q15053
Protein name Uncharacterized protein KIAA0040
Family and domains
Sequence
MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHCCWSPPGKRGQ
QPEKNKKKKKKKKKKDEEDLWISAQPKLLQMEKRPSLPV
Sequence length 99
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Astrocytoma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Melanoma Cutaneous Malignant Associate 32639949
Migraine Disorders Associate 32632093
Neoplasms Associate 32639949