Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9672
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDC3
Synonyms (NCBI Gene) Gene synonyms aliases
SDCN, SYND3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p35.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the syndecan proteoglycan family. It may play a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018892 hsa-miR-335-5p Microarray 18185580
MIRT030232 hsa-miR-26b-5p Microarray 19088304
MIRT446638 hsa-miR-654-3p PAR-CLIP 22100165
MIRT446637 hsa-miR-4677-3p PAR-CLIP 22100165
MIRT446635 hsa-miR-4679 PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 18093920
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186357 10660 ENSG00000162512
Protein
UniProt ID O75056
Protein name Syndecan-3 (SYND3)
Protein function Cell surface proteoglycan that may bear heparan sulfate (By similarity). May have a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 378 440 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the nervous system, the adrenal gland, and the spleen. {ECO:0000269|PubMed:11527150}.
Sequence
MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVD
LEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQ
PVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVP
ATVATATPSTPAAPPFTATTAVIRTTGVRRLLPLPLTTVATARATTPEAPSPPTTAAVLD
TEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTT
IRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGL
LDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT
LEEPKQASVTYQKPDKQEEF
YA
Sequence length 442
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Cytoskeleton in muscle cells
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Obesity Obesity, association with N/A N/A ClinVar
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Stimulate 29361890, 30718543, 40724840
Arthritis Associate 17545191
Arthritis Rheumatoid Associate 16052590
Breast Neoplasms Associate 23351331, 25617766, 33597614
Carcinoma Hepatocellular Associate 28557334, 36189226
Carcinoma Renal Cell Associate 29968393
Hypertension Associate 36447229
Hypoxia Stimulate 33117401
Hypoxia Brain Stimulate 33117401
IgA Vasculitis Associate 16052590