Gene Gene information from NCBI Gene database.
Entrez ID 9672
Gene name Syndecan 3
Gene symbol SDC3
Synonyms (NCBI Gene)
SDCNSYND3
Chromosome 1
Chromosome location 1p35.2
Summary The protein encoded by this gene belongs to the syndecan proteoglycan family. It may play a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism.
miRNA miRNA information provided by mirtarbase database.
414
miRTarBase ID miRNA Experiments Reference
MIRT018892 hsa-miR-335-5p Microarray 18185580
MIRT030232 hsa-miR-26b-5p Microarray 19088304
MIRT446638 hsa-miR-654-3p PAR-CLIP 22100165
MIRT446637 hsa-miR-4677-3p PAR-CLIP 22100165
MIRT446635 hsa-miR-4679 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 18093920
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186357 10660 ENSG00000162512
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75056
Protein name Syndecan-3 (SYND3)
Protein function Cell surface proteoglycan that may bear heparan sulfate (By similarity). May have a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 378 440 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the nervous system, the adrenal gland, and the spleen. {ECO:0000269|PubMed:11527150}.
Sequence
MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVD
LEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQ
PVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVP
ATVATATPSTPAAPPFTATTAVIRTTGVRRLLPLPLTTVATARATTPEAPSPPTTAAVLD
TEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTT
IRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGL
LDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT
LEEPKQASVTYQKPDKQEEF
YA
Sequence length 442
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules
Cytoskeleton in muscle cells
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Obesity, association with association rs2282440, rs2491132 RCV000013592
RCV000013593
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Stimulate 29361890, 30718543, 40724840
Arthritis Associate 17545191
Arthritis Rheumatoid Associate 16052590
Breast Neoplasms Associate 23351331, 25617766, 33597614
Carcinoma Hepatocellular Associate 28557334, 36189226
Carcinoma Renal Cell Associate 29968393
Hypertension Associate 36447229
Hypoxia Stimulate 33117401
Hypoxia Brain Stimulate 33117401
IgA Vasculitis Associate 16052590