WSCD2 (WSC domain containing 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 9671
Gene name WSC domain containing 2
Gene symbol WSCD2
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q23.3
miRNA miRNA information provided by mirtarbase database.
421
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (421)
miRTarBase ID miRNA Experiments Reference
MIRT607317 hsa-miR-8485 HITS-CLIP 23824327
MIRT614283 hsa-miR-329-3p HITS-CLIP 23824327
MIRT614282 hsa-miR-362-3p HITS-CLIP 23824327
MIRT607316 hsa-miR-603 HITS-CLIP 23824327
MIRT607315 hsa-miR-4704-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane ISS
GO:0005794 Component Golgi apparatus IEA
GO:0008146 Function Sulfotransferase activity IEA
GO:0008146 Function Sulfotransferase activity ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619253 29117 ENSG00000075035
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2TBF2
Protein name Sialate:O-sulfotransferase 2 (WSC domain-containing protein 2)
Protein function Sialate:O-sulfotransferase which catalyzes 8-O-sulfation at the Sia-glycan level using 3'-phosphoadenosine 5'-phosphosulfate (PAPS) as a donor, forming 8-O-sulfated Sia (Sia8S)-glycans. Displays selectivity toward glycoproteins such as TF/transf
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01822 WSC 130 → 209 WSC domain Domain
PF01822 WSC 233 → 314 WSC domain Domain
Sequence 
MAKLWFKFQRYFRRKPVRFFTFLALYLTAGSLVFLHSGFVGQPAVSGNQANPAAAGGPAE
GAELSFLGDMHLGRGFRDTGEASSIARRYGPWFKGKDGNERAKLGDYGGAWSRALKGRVV
REKEEERAKYIGCYLDDTQSRALRGVSFFDYKKMTIFRCQDNCAERGYLYGGLEFGAECY
CGHKIQATNVSEAECDMECKGERGSVCGGANRLSVYRLQLAQESARRYGSAVFRGCFRRP
DNLSLALPVTAAMLNMSVDKCVDFCTEKEYPLAALAGTACHCGFPTTRFPLHDREDEQLC
AQKCSAEEFESCGTPSYFIVYQTQVQDNRCMDRRFLPGKSKQLIALASFPGAGNTWARHL
IELATGFYTGSYYFDGSLYNKGFKGERDHWRSGRTICIKTHESGQKEIEAFDAAILLIRN
PYKALMAEFNRKYGGHIGFAAHAHWKGKEWPEFVRNYAPWWATHTLDWLKFGKKVLVVHF
EDLKQDLFVQLGRMVSLLGVAVREDRLLCVESQKDGNFKRSGLRKLEYDPYTADMQKTIS
AYIKMVDAALKGRNLTGVPDDYYPR
Sequence length 565
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Marfanoid habitus and intellectual disability Uncertain significance rs771199825 RCV000850441
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 35082309
Depressive Disorder Associate 36982982
Diabetes Gestational Associate 35721735
Multiple Myeloma Associate 33950175