CD63 (CD63 molecule)

Gene

• Entrez ID: 967
• Gene name: CD63 molecule
• Gene symbol: CD63
• Synonyms (NCBI Gene): AD1, HOP-26, ME491, MLA1, OMA81H, Pltgp40, TSPAN30
• Chromosome: 12
• Chromosome location: 12q13.2
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023517	hsa-miR-1-3p	Proteomics	18668040
MIRT052897	hsa-miR-3943	CLASH	23622248
MIRT525497	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT525496	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT525495	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT525494	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT732764	hsa-miR-483-5p	RNA-seq	33833530
MIRT732765	hsa-miR-342-5p	RNA-seq	33833530
MIRT525497	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT525496	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT525495	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT525494	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT2499857	hsa-miR-1185	CLIP-seq
MIRT2499858	hsa-miR-1245b-3p	CLIP-seq
MIRT2499859	hsa-miR-1468	CLIP-seq
MIRT2499860	hsa-miR-3150b-3p	CLIP-seq
MIRT2499861	hsa-miR-361-3p	CLIP-seq
MIRT2499862	hsa-miR-3679-5p	CLIP-seq
MIRT2499863	hsa-miR-3929	CLIP-seq
MIRT2499864	hsa-miR-4254	CLIP-seq
MIRT2499865	hsa-miR-4419b	CLIP-seq
MIRT2499866	hsa-miR-4436b-5p	CLIP-seq
MIRT2499867	hsa-miR-4478	CLIP-seq
MIRT2499868	hsa-miR-4689	CLIP-seq
MIRT2499869	hsa-miR-4695-5p	CLIP-seq
MIRT2499870	hsa-miR-4753-3p	CLIP-seq
MIRT2499871	hsa-miR-4766-5p	CLIP-seq
MIRT2499872	hsa-miR-4784	CLIP-seq
MIRT2499873	hsa-miR-4786-5p	CLIP-seq
MIRT2499874	hsa-miR-485-5p	CLIP-seq
MIRT2499875	hsa-miR-490-3p	CLIP-seq
MIRT2499876	hsa-miR-548ac	CLIP-seq
MIRT2499877	hsa-miR-548d-3p	CLIP-seq
MIRT2499878	hsa-miR-548z	CLIP-seq
MIRT2499879	hsa-miR-619	CLIP-seq
MIRT2499880	hsa-miR-765	CLIP-seq
MIRT2499857	hsa-miR-1185	CLIP-seq
MIRT2499858	hsa-miR-1245b-3p	CLIP-seq
MIRT2499859	hsa-miR-1468	CLIP-seq
MIRT2499860	hsa-miR-3150b-3p	CLIP-seq
MIRT2499861	hsa-miR-361-3p	CLIP-seq
MIRT2499862	hsa-miR-3679-5p	CLIP-seq
MIRT2499863	hsa-miR-3929	CLIP-seq
MIRT2499864	hsa-miR-4254	CLIP-seq
MIRT2499865	hsa-miR-4419b	CLIP-seq
MIRT2499866	hsa-miR-4436b-5p	CLIP-seq
MIRT2499867	hsa-miR-4478	CLIP-seq
MIRT2499868	hsa-miR-4689	CLIP-seq
MIRT2499869	hsa-miR-4695-5p	CLIP-seq
MIRT2499870	hsa-miR-4753-3p	CLIP-seq
MIRT2499871	hsa-miR-4766-5p	CLIP-seq
MIRT2499872	hsa-miR-4784	CLIP-seq
MIRT2499873	hsa-miR-4786-5p	CLIP-seq
MIRT2499874	hsa-miR-485-5p	CLIP-seq
MIRT2499875	hsa-miR-490-3p	CLIP-seq
MIRT2499876	hsa-miR-548ac	CLIP-seq
MIRT2499877	hsa-miR-548d-3p	CLIP-seq
MIRT2499878	hsa-miR-548z	CLIP-seq
MIRT2499879	hsa-miR-619	CLIP-seq
MIRT2499880	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002092	Process	Positive regulation of receptor internalization	IMP	23632027
GO:0005515	Function	Protein binding	IPI	16917503, 20374249, 25312088, 28030805, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	22431521, 23632027
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS	1993697
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16917503, 23632027
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1993697, 8661157, 9602068
GO:0007160	Process	Cell-matrix adhesion	IMP	23632027
GO:0009986	Component	Cell surface	IDA	15647390
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	IDA	15229288, 22660413
GO:0010633	Process	Negative regulation of epithelial cell migration	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IMP	23632027
GO:0030154	Process	Cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031088	Component	Platelet dense granule membrane	TAS
GO:0031902	Component	Late endosome membrane	IDA	23632027
GO:0031902	Component	Late endosome membrane	IEA
GO:0031904	Component	Endosome lumen	IDA	22660413
GO:0031982	Component	Vesicle	IEA
GO:0032585	Component	Multivesicular body membrane	HDA	12519789
GO:0032585	Component	Multivesicular body membrane	IDA	26280656
GO:0032991	Component	Protein-containing complex	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035646	Process	Endosome to melanosome transport	IMP	21962903
GO:0042470	Component	Melanosome	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0048757	Process	Pigment granule maturation	IMP	21962903
GO:0050931	Process	Pigment cell differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15908444, 21505438, 23092844, 26387950, 30871575
GO:0070062	Component	Extracellular exosome	IEA
GO:0097487	Component	Multivesicular body, internal vesicle	IDA	21962903, 26280656, 26387950
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IBA
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IMP	23632027
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	15647390
GO:2001046	Process	Positive regulation of integrin-mediated signaling pathway	IMP	16917503, 23632027

Other IDs

• MIM: 155740
• HGNC: 1692
• e!Ensembl: ENSG00000135404

Protein

• UniProt ID: P08962
• Protein name: CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
• Protein function: Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promote
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	10 → 230	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages. {ECO:0000269|PubMed:19640571}.
• Sequence:

  MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
  GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
  QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
  FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

• Sequence length: 238

Pathways

KEGG:

Virion - Hepatitis viruses
Lysosome
Proteoglycans in cancer

Reactome:

Platelet degranulation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NIGHT BLINDNESS, CONGENITAL STATIONARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PUNCTATA ALBESCENS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acidosis	Associate	34685701	★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Associate	24356513	★☆☆☆☆ Found in Text Mining only
Acute On Chronic Liver Failure	Associate	35330909	★☆☆☆☆ Found in Text Mining only
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells	Associate	27304079	★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Stimulate	16856976	★☆☆☆☆ Found in Text Mining only
Angina Stable	Stimulate	35942210	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Stimulate	11703349	★☆☆☆☆ Found in Text Mining only
Apical Hypertrophic Cardiomyopathy	Stimulate	35328555	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	36826611, 7621589	★☆☆☆☆ Found in Text Mining only
Asthma	Stimulate	33407109	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	36685514, 40534099	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	20693981, 29523123	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	17498581	★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	32860660	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	28296243	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	24884960, 28076321, 29069893, 34685701, 35579189, 36080806, 38403110	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	9737661	★☆☆☆☆ Found in Text Mining only
Calcinosis	Associate	25711438	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	12480921	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	21521534, 31820861	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	25033048	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Associate	20118909	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31820861	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	34122615	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	34065085	★☆☆☆☆ Found in Text Mining only
Chronic Urticaria	Associate	39273229	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	33942972	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	12480921	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22895844, 32589377	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	34638669	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	34548411, 35064006, 37302069	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Stimulate	25769931	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Stimulate	35710773	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	33674191	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	35710773	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	37576973	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	31957842	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	10193408, 16599242, 23298505	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Stimulate	24576111	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	35194965	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	30352458	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	30352458, 35124383	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Associate	32101370, 33218198, 35012489	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Inhibit	39490745	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Associate	21977985	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	20693981	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Stimulate	29523123	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	37928523	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26979459	★☆☆☆☆ Found in Text Mining only
Hermanski Pudlak Syndrome	Associate	26806224, 7682577	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	18321974	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	22998595	★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	31407387	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	24347249	★☆☆☆☆ Found in Text Mining only
Infections	Associate	16775336, 29120745	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	22545106	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	8655691	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	35046480	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriosclerosis	Associate	14985170	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	25833959	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	35121522	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	25033048	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	34684727	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Stimulate	11703349	★☆☆☆☆ Found in Text Mining only
Lymphatic Diseases	Associate	30222750	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	24884960, 30222750, 31820861	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	24952935	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	34745768	★☆☆☆☆ Found in Text Mining only
Mast Cell Activation Disorders	Associate	30970663	★☆☆☆☆ Found in Text Mining only
Mast Cell Activation Syndrome	Stimulate	35281031	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Stimulate	9822308	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Associate	25171703, 9822308	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	16116595, 19383316, 2070066, 21326294, 21977985, 23522389	★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	24098347	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Associate	37787787	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	39273229	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	33819512	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Stimulate	34065085	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	31820861, 37439349	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12480921, 20118909, 22998595, 24098347, 24884960, 28076321, 30222750, 30367559, 31588683, 32802193, 34377594, 34685701, 35328683, 36655866, 37441083, 38403110, 9736046	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	25033048	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	35638410	★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Inhibit	9822308	★☆☆☆☆ Found in Text Mining only
Peri Implantitis	Stimulate	30352458	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Associate	19608683	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27903962, 31674708	★☆☆☆☆ Found in Text Mining only
Pruritus	Associate	19608683	★☆☆☆☆ Found in Text Mining only
Purpura Thrombocytopenic Idiopathic	Associate	28409645	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Associate	37603355	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Inhibit	35046480	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Associate	16116595	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	21521534, 30222750	★☆☆☆☆ Found in Text Mining only
Stomach Ulcer	Associate	21521534	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Stimulate	30764484	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	27179277	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Associate	38158702	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Associate	32920367	★☆☆☆☆ Found in Text Mining only