Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9657
Gene name Gene Name - the full gene name approved by the HGNC.
IQ motif containing B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IQCB1
Synonyms (NCBI Gene) Gene synonyms aliases
NPHP5, PIQ, SLSN5
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33|3q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. The encoded protein has a central coiled-coil region and two calmodulin-binding IQ domains. It is localized to the primary cilia
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1141528 A>T Benign, pathogenic, likely-benign Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs121918244 G>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs121918245 G>A,C Pathogenic Non coding transcript variant, stop gained, missense variant, coding sequence variant
rs140630401 C>T Conflicting-interpretations-of-pathogenicity, likely-pathogenic Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs201405662 G>A,C Pathogenic, likely-pathogenic Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant, stop gained, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027674 hsa-miR-98-5p Microarray 19088304
MIRT030516 hsa-miR-24-3p Microarray 19748357
MIRT047676 hsa-miR-10a-5p CLASH 23622248
MIRT727435 hsa-miR-30a-5p HITS-CLIP 22473208
MIRT727434 hsa-miR-30b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001750 Component Photoreceptor outer segment IEA
GO:0005515 Function Protein binding IPI 18723859, 21565611, 23446637, 25552655, 26638075, 28514442, 29959317, 32296183, 33961781
GO:0005516 Function Calmodulin binding IDA 15723066
GO:0005516 Function Calmodulin binding IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609237 28949 ENSG00000173226
Protein
UniProt ID Q15051
Protein name IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ)
Protein function Involved in ciliogenesis. The function in an early step in cilia formation depends on its association with CEP290/NPHP6 (PubMed:21565611, PubMed:23446637). Involved in regulation of the BBSome complex integrity, specifically for presence of BBS2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00612 IQ 295 315 IQ calmodulin-binding motif Motif
PF00612 IQ 388 408 IQ calmodulin-binding motif Motif
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed in fetal and adult tissues. Localized to the outer segments and connecting cilia of photoreceptor cells. Up-regulated in a number of primary colorectal and gastric tumors. {ECO:0000269|PubMed:15723066, ECO:000026
Sequence
MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQ
YCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGR
QLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQI
GSAVMMMLQNILQINSGDLLRIGRKALYSILDEVIFKLFSTPSPVIRSTATKLLLLMAES
HQEILILLRQSTCYKGLRRLLSKQETGTEFSQELRQLVGLLSPMVYQEVEEQKLHQAACL
IQAYWKGFQTRKRLK
KLPSAVIALQRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAM
RLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAA
VTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSR
ELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAEGKEPELFLS
RSRPVAAKAKQAHLTTLKHIQAPWWKKLGEESGDEIDVPKDELSIELENLFIGGTKPP
Sequence length 598
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Leber Congenital Amaurosis leber congenital amaurosis rs750962965, rs1553722736, rs387907009, rs748559081, rs201405662 N/A
Nephronophthisis nephronophthisis rs1280238814, rs727503968, rs373909351, rs727503969, rs750962965, rs387907009, rs779696701, rs794727964, rs866982675, rs1474058708, rs398123538, rs201405662, rs1189889920, rs745340459, rs121918244
View all (1 more)
N/A
renal dysplasia and retinal aplasia Renal dysplasia and retinal aplasia rs866982675, rs1576559094, rs121918244 N/A
retinal dystrophy Retinal dystrophy rs373909351, rs745340459, rs1280238814, rs1553711564, rs750962965, rs866982675, rs1189889920, rs398123538, rs121918244 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bardet-Biedl Syndrome bardet-biedl syndrome N/A N/A ClinVar
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amaurosis hypertrichosis Associate 29322253
Bardet Biedl Syndrome Associate 25552655
Blindness Associate 36084637
Ciliopathies Associate 20007846, 21068128, 27491411, 36084637
Cone Rod Dystrophies Associate 38522724
Disease Associate 21220633
Hypertensive Retinopathy Associate 29219953, 38522724
Immunologic Deficiency Syndromes Associate 23446637
Kidney Diseases Associate 21220633, 36084637
Leber Congenital Amaurosis Associate 21220633, 21901789, 24066033, 26147992, 29219953, 29322253, 31212307, 32088401, 36084637, 40725491