Gene Gene information from NCBI Gene database.
Entrez ID 965
Gene name CD58 molecule
Gene symbol CD58
Synonyms (NCBI Gene)
LFA-3LFA3ag3
Chromosome 1
Chromosome location 1p13.1
Summary This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively splice
miRNA miRNA information provided by mirtarbase database.
50
miRTarBase ID miRNA Experiments Reference
MIRT875837 hsa-miR-149 CLIP-seq
MIRT875838 hsa-miR-4256 CLIP-seq
MIRT875839 hsa-miR-4267 CLIP-seq
MIRT875840 hsa-miR-4438 CLIP-seq
MIRT875841 hsa-miR-4725-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Activation 9733827
NFKBIA Repression 9733827
RELA Activation 9733827
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 17344209
GO:0005515 Function Protein binding IPI 7544493, 10380930, 28813417
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 7544493
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
153420 1688 ENSG00000116815
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19256
Protein name Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58)
Protein function Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presentin
PDB 1CCZ , 1CI5 , 1QA9
Family and domains
Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules
Epstein-Barr virus infection
  Cell surface interactions at the vascular wall
Neutrophil degranulation