Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
965
Gene name Gene Name - the full gene name approved by the HGNC.
CD58 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD58
Synonyms (NCBI Gene) Gene synonyms aliases
LFA-3, LFA3, ag3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively splice
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT875837 hsa-miR-149 CLIP-seq
MIRT875838 hsa-miR-4256 CLIP-seq
MIRT875839 hsa-miR-4267 CLIP-seq
MIRT875840 hsa-miR-4438 CLIP-seq
MIRT875841 hsa-miR-4725-5p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 9733827
NFKBIA Repression 9733827
RELA Activation 9733827
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 17344209
GO:0005515 Function Protein binding IPI 7544493, 10380930, 28813417
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 7544493
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
153420 1688 ENSG00000116815
Protein
UniProt ID P19256
Protein name Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58)
Protein function Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presentin
PDB 1CCZ , 1CI5 , 1QA9
Family and domains
Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Epstein-Barr virus infection
  Cell surface interactions at the vascular wall
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 2473473
Anemia Sickle Cell Stimulate 26137540
Arthritis Rheumatoid Associate 12417058, 19898481, 9099931, 9099936
Astrocytoma Associate 37904707
Atherosclerosis Associate 32229536
Bone Marrow Diseases Associate 8098967
Burkitt Lymphoma Associate 1691936
Burkitt Lymphoma Inhibit 2898508
Carcinoma Hepatocellular Associate 34423049
Carcinoma Hepatocellular Stimulate 37573318